Conserved Protein Domain Family
DUF4363

?
pfam14276: DUF4363 
Domain of unknown function (DUF4363)
This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.
Statistics
?
PSSM-Id: 316768
View PSSM: pfam14276
Aligned: 110 rows
Threshold Bit Score: 56.0505
Threshold Setting Gi: 503264871
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123322307   8 LAILLVVLAAGFWTNHSLLQSTKDLSRQIERVSQEIKQEQWEAAQKQNRQLEKTWQEKARWWPIILDHQEIDNIEFSLAK 87
gi 524401639   8 ILFLLLVAGLCIFEQHTVKTTFENMETLLQSMDAAAAEENYPEAERKARQLQNIWTARYPTLCVLMEHRALQEAGVTLGT 87
gi 524819526   8 aVLVTIAFAICFTEIYAIKNSRDTFTKTIEESRIAMENKDYEKAKELSEELIKKWDKQEKKLNYLMEHSLLDEISMDIQQ 87
gi 547883192   8 IIILTVIAAMSVFSVFAVKKENDKFISLVNAAENSYRNDDSDTAQR-LEELENAWNKYYVRISYIAQSCTLDDISYAVAK 86
gi 524491669   8 IVLLIICSGVCIIEQVTINKVCSETTSIINTALYLNEQKDFLKAKSQCEKLRKIWSKRYPYLSAMIDHSQLDGAGAAI-K 86
gi 524315253   8 cgIFAALIALSCGSLYMLKRCNSGLYERIDDCMAQYEAG-SDGVYESVERLQDYWGEYYVKVSFLTRSSTLDDISYSVAK 86
gi 524247686   8 aIFMLAALSLCFGEQIYISRDCREMITAISEAE---ECESTPEKLKYCAEIYDMWSDYHKKASYVTDHSVLQSADVSMGT 84
gi 524782922   8 VTLIVLIIIYSVTSLFILDNQNDLLKGRIEKIQQVYESGDVEGALALSNELNDFWHSYERKVTMIIHDDALANLNISIAK 87
gi 524322348   8 ialllgilslslFALFQCRYYCTQTAEQVSQIIQYAENGRLDQAAILAEQLSESWSKTKNSMVWYIRYEPLERISDITSH 87
gi 524088335   8 aVFILAALSLCAFEQFYVYKDCKEIITHIDTA---IDETDLAAKKEKCAAIEDEWEDFDRLATYITDHAILHSAEISIGT 84
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 123322307  88 IKEYVASHNLPLALGQLSELKLMIEHIPRKEAVNLENI 125
gi 524401639  88 LQPLAGDES-DDLRPTIRQCQTELAEIYDNSKVTVGNI 124
gi 524819526  88 LPEYTNEDGKEDYLSANDRIKKQFNVLYTNELPYGDNI 125
gi 547883192  87 LPALLEKGS-EEFLSECESIRSWTEKIYHTQYPHLysv 123
gi 524491669  87 ATKDISKENEDELSEKLIEAKDEIQLLKENQSITLGNI 124
gi 524315253  87 LEPLLD-EESEEFVSELRSIRFWAFLVYESQIPHFRSV 123
gi 524247686  85 LKSLPPDSSAESINELLAQAKSETQQIYDNSRISLSNI 122
gi 524782922  88 VTPFISNEN-DELIAEIQAIYHQIDQIYEEEFPSWYNI 124
gi 524322348  88 LEFLARYNDLPQLMAQANQLLTCVHELYDNELPLLRNl 125
gi 524088335  85 LNDLNDLNE-EDTNEALIEAKSEIEQVYDHSRINLSNI 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap