Conserved Protein Domain Family
RRM_5

?
pfam13893: RRM_5 
RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
The RRM motif is probably diagnostic of an RNA binding protein. RRMs are found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. The motif also appears in a few single stranded DNA binding proteins.
Statistics
?
PSSM-Id: 338992
View PSSM: pfam13893
Aligned: 5 rows
Threshold Bit Score: 186.534
Threshold Setting Gi: 568926557
Created: 30-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 242021201    6 NFRHNPGFQGSPALLST---SGALGVTTGPVMMVYGLDTKKLNCDKLFNLFCLYGNIARIKFLKTKEGAAMIQMGDGSAV 82
gi 733876639    2 GSRDTPELVAYPLPQASs-sYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAV 80
gi 568926557  297 PGALGPLTLTSSAVSGRmaiPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQA 376
gi 1109011984 129 SQRYGPGYGPPPPEYGP--------HADSPVLMVYGLEPSKINADKVFNIFCLYGNVERIKFMKSKPGAAMVEMGDCYSV 200
gi 116007726    4 PAGVVPGRNAPVAFTPQ-------GQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAV 76
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 242021201   83 ERCVQHLNNAPMFDSknRLQLGFSKQPFLSDvTNPFVLPDGSPSFKDFIRN 133
gi 733876639   81 ERAVTHLNNVKLFGK--RLNVCVSKQHSVVP-SQIFELEDGTSSYKDFAMS 128
gi 568926557  377 QLAMNHLSGQRLYGK--VLRATLSKHQAV---QLPREGQEDQGLTKDFSNS 422
gi 1109011984 201 DRAITHLNNNFLFGQ--KLNVCVSKQQAIVP-GQCYQLEDNTSSFKDFHGS 248
gi 116007726   77 ERCVQHLNNIPV-GTggKIQIAFSKQNFLSEvINPFLLPDHSPSFKEYTGS 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap