Conserved Protein Domain Family
RRM_5

?
pfam13893: RRM_5 
RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
The RRM motif is probably diagnostic of an RNA binding protein. RRMs are found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. The motif also appears in a few single stranded DNA binding proteins.
Statistics
?
PSSM-Id: 338992
View PSSM: pfam13893
Aligned: 5 rows
Threshold Bit Score: 186.534
Threshold Setting Gi: 568926557
Created: 30-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002431034   6 NFRHNPGFQGSPALLST---SGALGVTTGPVMMVYGLDTKKLNCDKLFNLFCLYGNIARIKFLKTKEGAAMIQMGDGSAV 82  human body louse
XP_010704839   2 GSRDTPELVAYPLPQASs-sYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAV 80  turkey
XP_006537917 297 PGALGPLTLTSSAVSGRmaiPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQA 376 house mouse
XP_019109122 129 SQRYGPGYGPPPPEYGP--------HADSPVLMVYGLEPSKINADKVFNIFCLYGNVERIKFMKSKPGAAMVEMGDCYSV 200 large yellow cr...
NP_001036561   4 PAGVVPGRNAPVAFTPQ-------GQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAV 76  fruit fly
XP_002431034  83 ERCVQHLNNAPMFDSknRLQLGFSKQPFLSDvTNPFVLPDGSPSFKDFIRN 133 human body louse
XP_010704839  81 ERAVTHLNNVKLFGK--RLNVCVSKQHSVVP-SQIFELEDGTSSYKDFAMS 128 turkey
XP_006537917 377 QLAMNHLSGQRLYGK--VLRATLSKHQAV---QLPREGQEDQGLTKDFSNS 422 house mouse
XP_019109122 201 DRAITHLNNNFLFGQ--KLNVCVSKQQAIVP-GQCYQLEDNTSSFKDFHGS 248 large yellow croaker
NP_001036561  77 ERCVQHLNNIPV-GTggKIQIAFSKQNFLSEvINPFLLPDHSPSFKEYTGS 126 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap