Conserved Protein Domain Family
DUF4201

?
pfam13870: DUF4201 
Domain of unknown function (DUF4201)
This is a family of coiled-coil proteins from eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 316393
View PSSM: pfam13870
Aligned: 50 rows
Threshold Bit Score: 87.2564
Threshold Setting Gi: 121968532
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124450837 574 ESAKNKTLQELRLDTLRLKNTLAKNQKQLKKKEELAEGLHLIDFEQLKIENQTLNEKIEERNEDLHKLKNKNTKTVQMLT 653
gi 121968532 166 ERQKDALIAKYSSKRTNLERQILKTNNQIQKKEEMGDDLKFIDFYQLQIENKKYVKEIDDKNKKLLALKISTNRISQTLK 245
gi 82180633  164 IKAKDILIEKLHRKNSALLTHKKKQQAQLRQQEEMAEGVTVLDFELLKFENIRFRKQLDEQNLKQVNLKLLAVKTLQTLN 243
gi 81876708  179 NRRRDNIKDKLCLKNVSLKVQRKKMLSQLRQKEEVGEALHDVDFQQLKIENAQFLETIEARNKELIQLKLASGNTLQVLN 258
gi 74717983  179 NRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLN 258
gi 124472474 484 ESARNKTLQELRLDALRQRNILTKQQQQLKKKEELAEGLHLIDFEQLKIENQTLNEKIEERNEDLQKQKNKNMKSVLMFS 563
gi 94707508  365 EDKKEKEMSAVRLENIQLKQSLVHFETRMRTQEDLTQGLLLIDFEQLKIENQTFNEKIEERNEELLKLRSKVTNSVQVIT 444
gi 121989175 519 MNVKRNEISDTRLVLITMKHTLGRLTEKINQLERVGDDLYINDFISIQNQVVTLDKKIEERNIELKKLRCKYHVDLHVIQ 598
gi 74864628  487 MQDLRNQISEKRYELNLNLHNLAFVDEKVMKFERVTETLTISQMLCANESIIQLSKQLEEKCKDVAVMQSNYKKSMIEET 566
gi 122001086 496 MRAKRDALSATRLILIIRQHDNSYIKKKVDEIEAISGEVKLETYLSADNDVQQMVTTLNNKNAELERMCTLVKTKIHTIS 575
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124450837 654 HTREKLG-------YVKAKFQDQEKINQKKKDELEALRKNLGEQKESKDKLRTENLKLKQQTGIvNRPELIQdYSNRKKN 726
gi 121968532 246 DEKQNLKqeldkgkEYASQMSERKKKISKIDAQIKSVKKVTSKLEKDRKIYDKQKEIFVQDNQD-DVPQIMK-YVQYKSK 323
gi 82180633  244 SNKEKLH-------ILTNESEMLSSDTALRTKLLVKIEEETEQAEEERHKAEALNRKLRDQLADfHVPHVLQ-YIKLKES 315
gi 81876708  259 TYKNKLH-------RAMEIYVNLDKEILLRNELLGKIEKETIQAEEDRAKAHILNDKLRKQLAEfRAPQVMMy-VKEKIL 330
gi 74717983  259 AYKSKLHk------AMEIYLNLDKEILLRKELLEKI-EKETLQVEEDRAKAEAVNKRLRKQLAEfRAPQVMT-YVREKIL 330
gi 124472474 564 HTREKLG-------HVGQKFQDQEKINYKKKDTLDGLRKSLGEQKVYKDKLRTENLKLKQQTGIvNRPELMQdYSNRKSN 636
gi 94707508  445 HVKEKLH-------FMDMENACKKTQLAEIEAQAALGRDILTKTKQAREGLRTDNIRLNQKCGLlGKDSLLRdLEEKVDK 517
gi 121989175 599 HNREKAL-------ALAHKLQLCKASLEKLLDTQHAKREDLYRAKMDRTRLRKQQKEMSYQGGIlSMPSLMYeYDNTVKG 671
gi 74864628  567 CVREKRD-------MISYMLSKARAEYIDRFERRNKLRKDLTRLQLEHADLKTKRDKLETKGGLlFKPGLMYdYDKCMAD 639
gi 122001086 576 HLRCRRK-------LLNRKFREAKDELRERQKRQIALRDEVYNCNLTHNKLLDQIKEVRREGGImCYPKLLAdFDRTEKF 648
                        170       180
                 ....*....|....*....|....
gi 124450837 727 IDQLKVELEQLEQKLKHMQKVIDE 750
gi 121968532 324 EQQLLYAIQNLERKIEIAELAYKK 347
gi 82180633  316 HGQLQKSVREWERKVEIAEMALKT 339
gi 81876708  331 NGELEKTIKMWERKVEIAEMSLKG 354
gi 74717983  331 NADLEKSIRMWERKVEIAEMSLKG 354
gi 124472474 637 QDQLRDEL-----GHKEVLLLCQY 655
gi 94707508  518 TELLHRRLESLKRHHASLTLSCRG 541
gi 121989175 672 LLVKRTSVFKLRETLKNLNRRIQE 695
gi 74864628  640 IQARRSHIQAMKKTCNELGKRIRa 663
gi 122001086 649 IAIKQASIVELKTQHDNLLKRIEK 672
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap