Conserved Protein Domain Family
DUF4200

?
pfam13863: DUF4200 
Domain of unknown function (DUF4200)
This family is found in eukaryotes. It is a coiled-coil domain of unknwon function.
Statistics
?
PSSM-Id: 338977
View PSSM: pfam13863
Aligned: 185 rows
Threshold Bit Score: 29.4456
Threshold Setting Gi: 575000484
Created: 12-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A9UQN0        34 LLEKRRELEQVERALATQKED-FHVRMATLDQRKAELERKE--YQLQESLLKFDRFLKENDARRERAEQKAASENEVAQA 110 Monosiga brevic...
XP_006632629  69 vLKKEVEVEDINRQLTTKRQE-FANRMEALARRKAEFELKQ--KLTKERALKFDKFLQDNESKRRRALRNYQMERKHNEL 145 spotted gar
XP_002113559  60 LLKKEIEVDQVQNELDAKREE-FARRMQACTERRVELEKKQ--QTIKDRIQKFEKFLNENEAKRKRAIQKYQVEHRTREQ 136 Trichoplax adha...
XP_006010246  70 vLKKIVEVNQVDAELNAKKEE-HRKRMEVLALKREELEKKK--QAYEELVLNFDKFLRDNEAKRIRATQNYQKQVKENKI 146 coelacanth
XP_004066747  64 vIRKKAELDEMDVQLALKRHE-FKRCMGALATRRSELETKQ--QQTQERMEKFEKFVGENEVKRCKALQKCEATREQNFL 140 Japanese medaka
XP_003726234  64 LLKREVEVDDVTQELRTKRIQ-FQKRMEECEKKRVDLQKKQ--QLMKDRVEKFDKFISETEAKRRRAIHKYQQELKVKEQ 140 purple sea urchin
XP_002122109  63 LLRKAVEMEVVDKELAEKREE-FRIRMEKNKNKEDLLRKRQ--EKIKERVAKFDKFLKDNDAKRSRALRKYQIEVKDNKL 139 vase tunicate
XP_002665319  64 vLKKREELDNINTHLTHTRAQ-IQQRMRSLTERRELLQRAQ--EESRQRAERFQRFVEENELKRRRAMKKLQMEKQQSQS 140 zebrafish
XP_007667590  67 vLKAQVEVHHMNEALASKRRE-FQSRMEAVAQRRAELEKCQ--QDNQERALQVDKLRKDRDLKRSWVMQKCQAEARQNEI 143 platypus
XP_001630218   1 ----maESDKYKLELEEQKKNvFVTQLREEDDEDVETRKYQvvNEIRDRVGKFEKFIKENEAKRRRAVQKYQTELKLKDQ 76  starlet sea ane...
A9UQN0       111 REEQVQNLRAELRSLQERKTRNRDILQRYSIFEAFMQTVLGE 152 Monosiga brevicollis
XP_006632629 146 KEKEIQDLLQELEKLQVRQQHLKKKVEKNKMHEDYLLKIIDh 187 spotted gar
XP_002113559 137 KTVELELLKQQLAEYQQQNRRLKLLVERYSVFEKFLQLVVER 178 Trichoplax adhaerens
XP_006010246 147 KESEKNGLVQDLEKLRIRQQMLHERVAKCKIFEDFLLHAVER 188 coelacanth
XP_004066747 141 KQREIEDLAEQLKQLRTRKQVLKEKMQKYKIYEDYLMKTLNf 182 Japanese medaka
XP_003726234 141 KQSEYELLREQLEELKTRHNKLNEKIKQYKKFEEFLMKVLDN 182 purple sea urchin
XP_002122109 140 KTKQLQDYLRELEFARKNKEDLVKKLQSHKKFEDYMMQVIDA 181 vase tunicate
XP_002665319 141 KEEERGELANQMERLQDRRMRLKQRVSRYKIFEEFLMKTLEl 182 zebrafish
XP_007667590 144 KQGEIDELVQELERLQVRQKQLQKKVAKNKMFEDYLMKTINQ 185 platypus
XP_001630218  77 KSKEEEILAAELQQLKARKHSLEAKIAKYSVYEKYLLKVLDF 118 starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap