Conserved Protein Domain Family
DUF4200

?
pfam13863: DUF4200 
Domain of unknown function (DUF4200)
This family is found in eukaryotes. It is a coiled-coil domain of unknwon function.
Statistics
?
Aligned: 189 rows
Threshold Bit Score: 30.2233
Threshold Setting Gi: 574747071
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_018648014  52 LLEKYKELKNVQSALTAKKEEFRVKMECMQRRREDLEKKECELKESLIKFDQFFKDNDEKRVRAMKKISAEKGLQQQKQT 131 Schistosoma man...
EAY05970     104 kIAEKRDIYLIQLILNQKGKNLDQLVQQMENEKEMVEVTENKIIEESHQCQRESDRIELELQKGRKRAEQATQARVDIEK 183 Trichomonas vag...
EAY13005      98 FINEKREIYLTQLLIDRKNKEINQLNNQMKQNDLKLQKSEAEFDETVSKVEKATQIVELKLIQGRKAAEIASQDRCEKER 177 Trichomonas vag...
EDO82094     165 YMSKQRDIFLAELSLQTKKSEIDNINNQIRAKEDNLKAEVKKLDVEVSKFDKFIRHSDLGTVKTISESEKAVKARTQRQE 244 Giardia lamblia...
CDS25847     242 FIEDRKNICLMNLSTQINEEEIARLTNRLKEESDYLALAEGELTGQREDHDRFIQELTLRTTESIKRAEEANSKRVYRMD 321 Hymenolepis mic...
GAA54007     248 FVQDRRRVCLLELAVRTKKGEVKRLDAILHAENEFLKKEEHELIRRHEDHDRYLKSICQRTAEAIRLAEGEARKRNEITE 327 Clonorchis sine...
CBY15532     112 LLADKRRIFHRQFGILSKKAAIMQITERADVAEKETDDREVRLGKETIAFDEHLHDANAAAISAMQEADEMSRQHRRKNA 191 Oikopleura dioica
Q381R6       105 FIAKKREVGLMRLALANKESEIRHLEEEMDRVDKKLRQQQEQLASTEEKFNNFLKYSNLEQDAAVRRAERESKAKQKRLI 184 Trypanosoma brucei
Q4Q578       103 FVQQKREVGLVRMSLTTKKAEIRKLEEKIHRAEKRLHQQQEQLSNTREKFNSFLKFSNLEQDAAVRRADDETRSKHAKTI 182 Leishmania major
EED93869      89 IISDKRELLLLNLAIQTQLDEINKLHDTIEQRGNELDAKEQELDESITRFGVFVKENEDSYAQADVQAEREYKKRQEKTT 168 Thalassiosira p...
XP_018648014 132 EINILNDDIDRLTKMREKQEKKVKSLLKYRLFLESVVKM 170 Schistosoma mansoni
EAY05970     184 VLHKRDNINGVIQSEISRNEDYLIQYQQYYEFLQQVKPD 222 Trichomonas vaginalis G3
EAY13005     178 LLRQRQTSIEILKSEIKKDLWTLEEYEEYYNFLQSIIPE 216 Trichomonas vaginalis G3
EDO82094     245 MIRNTSSQILALKSEITKHELSIRQLHRYRLFLDQLISI 283 Giardia lamblia ATCC 50803
CDS25847     322 MLKRFTHRINAMEAEYIKLEDEYKRLKTYKDFLDSVAKN 360 Hymenolepis microstoma
GAA54007     328 RIKRARYRLAHLNAECVKLEEEYLRLSTYKNFLRNVFDT 366 Clonorchis sinensis
CBY15532     192 EIKKITGLIAEIRSEICRMEDKFGVKDEIKQFVNLVhhn 230 Oikopleura dioica
Q381R6       185 DIKKLSAQINHLEQDMRKTEVQLELCMEYKTFMDNLTPP 223 Trypanosoma brucei
Q4Q578       183 EIKKLSALISHAEAEMRKTRVQIENCVAYKDFLEILAkp 221 Leishmania major
EED93869     169 TVSNLTQQLQTIQADIAKQADALAEYTGYATFLGNMTPD 207 Thalassiosira pseudonana CCMP1335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap