Conserved Protein Domain Family
7tm_4

?
pfam13853: 7tm_4 
Olfactory receptor
The members of this family are transmembrane olfactory receptors.
Statistics
?
PSSM-Id: 290564
View PSSM: pfam13853
Aligned: 5 rows
Threshold Bit Score: 382.223
Threshold Setting Gi: 190359996
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9H342        34 FSLIYIIIFLGNGIILHVIRTDIALHQPMYLFLAMLALAEVRVSASTLPTVLGIFLFGNTEISLEACLFPDV-LHPFFIH 112 human
4_pfamImport   1 FCAVYLIALTGNLTILFVIKTESSLHQPMFYFLAMLAAIDLGLSTATIPKMLGIFWIHLREIFFEACLTQMFfIHKFTLM 80 
3_pfamImport   1 LCFMYLVSILGNCTILFIIKTERSLHEPMYLFLSMLALIDLGLSLCTLPTVLGIFWVGAREISHDACFAQLFfIHCLSFL 80 
1_pfamImport   1 FCLMYIIIFLGNGTILHVIRTEASLHQPMYLFLAILALAEVGVSASTLPTVLGLFLFDTTEITFEACLLQMFfIHSFSIM 80 
2_pfamImport   1 FSSIYALVFLGNCMVLHVIRTESSLHQPMFYFLAMLALTDLCMGFSTVYTVLGILLGLIQEISLDSCIAQSYfIHGLSFM 80 
Q9H342       113 DGASCAAGHV--FGPLYSHLQPTELHSYP---DTAQGLWHRSYY---------RTEKHYAHGSVAHSlmasallwpqcpl 178 human
4_pfamImport  81 ESAVLLAMAYdrYVAICNPLRYSTILTNKvvsVIGLGVSVRAFIfvlpfifliLRLPFCGNHVIPHT------------- 147
3_pfamImport  81 ESSVLLSMAFdrFVAICRPLHYASILTNTvigRIGLVSLGRSIAlifplpfmlKRFSYCGSPVLSHS------------- 147
1_pfamImport  81 ESAVLLAMSVdrFVAIYSPLRYTAILTLPrifRTGAIIGLKSVIlmaplpvllRRLPFCGHNALSHS------------- 147
2_pfamImport  81 ESSVLLAMAFdrYIAICYPLRYSSILTNDkimKIGVAILCRSSLlippviirlKFLNYCRPHILSHS------------- 147
Q9H342       179 tFLLSAPQSYLSCGNISVNNIYGIfIVTSTFGLDSLLIVISYGLILHTVLGIATGEGRKKALNTCGSHVCAVLAYYVPMI 258 human
4_pfamImport 148 -YCEHMGLARLSCASIKVNIIYGL-CAICNLVFDIIAIALSYVQILRAVFRLPSREARLKSLSTCGSHVFVILAFYTPAL 225
3_pfamImport 148 -YCLHQEVMKLACADIKANSIYGMfVIVSTVGIDSLLILFSYSLILRTVLSIASRAERLKAFNTCVSHICAVLLFYTPMI 226
1_pfamImport 148 -YCLHPNLIHLPCGDISINNIYGLfVVTSTFGIDSLLIVVSYGLILHTVLGITTGDGRKKALNTCGSHICAVLAYYVPMI 226
2_pfamImport 148 -FCLHQDLIRMACSDVHFNSIYALtLVIINLLLDAVLILISYIRILHTVLAIASREERLKSLQTCVSHICAVLVFYIPII 226
Q9H342       259 GLSIVHRLGHRVSPLLQAMMANAYLFFPPVVNPIVYSIKTKEIHGAIVRMLLEK 312 human
4_pfamImport 226 FSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQIYDCVKKILLQK 279
3_pfamImport 227 GLSVIHRFGKQVPHLVQVVMGFMYLLFPPVMNPIVYSVKTKQIRDRVTHAFCN- 279
1_pfamImport 227 GLSMVHRFAHHVSPLLQTMMANAYLFFPPVINPIVYSIKTKEIRRVIIRMLSEK 280
2_pfamImport 227 GLTMVHRFGKHLSPLVHVLMGNIYVILPPMMNPVIYSIKTQQIQKRVQRLFCMK 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap