Conserved Protein Domain Family
GAS

?
pfam13851: GAS 
Growth-arrest specific micro-tubule binding
This family is the highly conserved central region of a number of metazoan proteins referred to as growth-arrest proteins. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localization of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages. Gas8 is a microtubule-binding protein localized to regions of dynein regulation in mammalian cells.
Statistics
?
PSSM-Id: 316375
View PSSM: pfam13851
Aligned: 67 rows
Threshold Bit Score: 100.367
Threshold Setting Gi: 583223039
Created: 9-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0D5C4       216 ELINNHETAFAELKQYYNTITRENLELIKNQKEEIASINAKLQKNSKIIADMKAANNNIRIPLKQATEERDILKNALKQF 295 Paramecium tetr...
Q23YW7       218 ELMNNHEKAFAELKKYYNDITAENLNLIKAHKEKIAQIYANIQLNTKNVADNQAKNEQLKEPLAKHREIRNKLKEDLKQF 297 Tetrahymena the...
Q8I505       220 SIKEIHMVVLENYKKYYIDQLKENIKKIKSLKEKINELEINDKEIKNDLSVHNNEYYSMVENIKNLELKRENLKKDLKFY 299 Plasmodium falc...
Q4YR54        52 DISEIYMNMINDYKKYYFNQIRENITKIKLLKKQINELEANDKEAKSDINIYSTENLSMLENIKTLEINRENLNKALKFY 131 Plasmodium berghei
KYF48930     227 ELMAGHRSAFEQIKAYYNDITHDNLQLIKELRKDIAEMKARAKITRKQMQDTQQENLQLREPLRQQQQLKEKLEQQLRFY 306 Toxoplasma gond...
XP_001303746 257 QLQEKHALAFDHIKRFFSGVTHNNLEVIKNSKAKIAQSKTLINSVRKDVDERFARRRELEEPLKAIKEENEKLHKEIDDY 336 Trichomonas vag...
XP_001325045 217 RLIKSHKKAFQEMRNFYNKITQDHLSYIAQYSAEYEAIQARLRDYEQRKKKYDKEINDLNKELHVQREENGNLHKILSTY 296 Trichomonas vag...
KMZ89948     219 SINEIHVDMLQNCKNYYIEQIRENIGKIKSLKSNICELDERDREIKNNLSVHSSQNLDMTEKIGALEVKRENLNKDLKFY 298 Plasmodium viva...
ETO31076      68 DLINNHQNAFAKMRAYYNAITKDNLDLITALKNELEELEEKAKSHENRYQQISIENKKLSVPLEQVQQQVEQFRKKLTNY 147 Reticulomyxa fi...
XP_001323538 216 ETEMQHATEMEQLQNYYQKTTQEQLETIKDLKSKIARLRPQDTQQTQEFDNSEKKKSVLLLEIEKLQKENNELKLKTQDA 295 Trichomonas vag...
A0D5C4       296 SKHKMSLQNLQSKNTTLTEKYAELKHNSNDLNFKYDKLLREKQELEEKFERI----AMEVKKHTDLQNNVLGQQLQNMQD 371 Paramecium tetr...
Q23YW7       298 AKHKMSLQNLKSKAITLKDKITKLERDGKDLDEKYEKVVREKQELEKKFEDI----TQEVKKNADLNNNVLSNRLQILLK 373 Tetrahymena the...
Q8I505       300 SKDFVIYKNLELIYNESDVHIKNLKQFSQSSRDKITQVEKELKRISEDELN-----VDDYFEDIKKKNILLKKKIESIDI 374 Plasmodium falc...
Q4YR54       132 SKDFVMYKNLELIYNENNVYIKNLKVFSHSFKEKILQVENAFIDLSKNENDG----FDDYFENIKNKNMCLKNKIKSLNL 207 Plasmodium berghei
KYF48930     307 VKDKMALQNIRARDTQLEEKVKAAKKHNHQMEQQKHKLERDIGEYTRRLRNL----QSDTSLRTQAKIMLYEQKVRQMLK 382 Toxoplasma gond...
XP_001303746 337 KRAKSKLAQNKSKIKVLEEEKRNLQLAQEVLEQRFEQLEQERDALYDQFETS----IHDVRQRTEFRAFILEQKVQKMHE 412 Trichomonas vag...
XP_001325045 297 DSDKMALQNSKNMIESLTAEIDSLKHQHSVKLAKFKKMEQEKEQLLEKFEAS----VHDVKQKTEFRALLLEKRVETLGE 372 Trichomonas vag...
KMZ89948     299 SKDFVIFKNLELIYNESNMYIKNLREFAQNSKEKISQVEEAFQELPQGDDQNgdayFEGYFEDIKNKNRLLKKMVQNIDL 378 Plasmodium viva...
ETO31076     148 HK---SLKASKTRLSVLDERLRDTISDFENLKHEFEALQQSKKELQKSHEDD----VNTMTDDFEKRKTDQIQKILLLQQ 220 Reticulomyxa fi...
XP_001323538 296 DKLSAELKKVTEVVEELEDEKENELIADEVLSKRFEQLEEERNAMYDQFEAM----IKDVHQKAEFRGYILAQKIQKMNE 371 Trichomonas vag...
A0D5C4       372 GLEEKEVQLKTIVERVNMDPQMYQQLTIKIKESIEAKNQLVKNL 415 Paramecium tetraurelia
Q23YW7       374 EYNNKEEELRTIIDNAGLDHNLHEQLKQRVQQSIEAKNTLIKNL 417 Tetrahymena thermophila SB210
Q8I505       375 NLDDINKEFQSYIKENNIKDEDVQNVRKGINFCLNTYNREFDNL 418 Plasmodium falciparum 3D7
Q4YR54       208 NLESLDKELNLYIKEKGIKQEDVITVRKGIDFCMRTYNKEFDNL 251 Plasmodium berghei
KYF48930     383 SLEHKFREREQLVASLKLSPEASMHIVELLRRSFCEKNDEIETL 426 Toxoplasma gondii ARI
XP_001303746 413 VLEQKEMQLQQVMQRKGLDATA---ISAKIEDVMAVKNARINQL 453 Trichomonas vaginalis G3
XP_001325045 373 VLKKKEGSLEEMIETSEIPQDQVQAIAEQVADLLRAKNAVIDNL 416 Trichomonas vaginalis G3
KMZ89948     379 DMDAVNKELTSYINSHHLRDDDVQKVRQGINFCMQTYNKEFDNL 422 Plasmodium vivax Mauritania I
ETO31076     221 QTDQQEKRVDELVKQQNIDTLTLSNWSEELKQTLKDKNQEIEYL 264 Reticulomyxa filosa
XP_001323538 372 MLDSKERQLQTSIAKGSV----GNAMQVKIDQALAEKNSRINQL 411 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap