Conserved Protein Domain Family
GAS

?
pfam13851: GAS 
Growth-arrest specific micro-tubule binding
This family is the highly conserved central region of a number of metazoan proteins referred to as growth-arrest proteins. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localization of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages. Gas8 is a microtubule-binding protein localized to regions of dynein regulation in mammalian cells.
Statistics
?
PSSM-Id: 316375
View PSSM: pfam13851
Aligned: 67 rows
Threshold Bit Score: 100.367
Threshold Setting Gi: 583223039
Created: 9-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124448433  216 ELINNHETAFAELKQYYNTITRENLELIKNQKEEIASINAKLQKNSKIIADMKAANNNIRIPLKQATEERDILKNALKQF 295
gi 121982066  218 ELMNNHEKAFAELKKYYNDITAENLNLIKAHKEKIAQIYANIQLNTKNVADNQAKNEQLKEPLAKHREIRNKLKEDLKQF 297
gi 74862658   220 SIKEIHMVVLENYKKYYIDQLKENIKKIKSLKEKINELEINDKEIKNDLSVHNNEYYSMVENIKNLELKRENLKKDLKFY 299
gi 74988167    52 DISEIYMNMINDYKKYYFNQIRENITKIKLLKKQINELEANDKEAKSDINIYSTENLSMLENIKTLEINRENLNKALKFY 131
gi 1005162325 227 ELMAGHRSAFEQIKAYYNDITHDNLQLIKELRKDIAEMKARAKITRKQMQDTQQENLQLREPLRQQQQLKEKLEQQLRFY 306
gi 123410632  257 QLQEKHALAFDHIKRFFSGVTHNNLEVIKNSKAKIAQSKTLINSVRKDVDERFARRRELEEPLKAIKEENEKLHKEIDDY 336
gi 123487900  217 RLIKSHKKAFQEMRNFYNKITQDHLSYIAQYSAEYEAIQARLRDYEQRKKKYDKEINDLNKELHVQREENGNLHKILSTY 296
gi 901875885  219 SINEIHVDMLQNCKNYYIEQIRENIGKIKSLKSNICELDERDREIKNNLSVHSSQNLDMTEKIGALEVKRENLNKDLKFY 298
gi 569425846   68 DLINNHQNAFAKMRAYYNAITKDNLDLITALKNELEELEEKAKSHENRYQQISIENKKLSVPLEQVQQQVEQFRKKLTNY 147
gi 123481334  216 ETEMQHATEMEQLQNYYQKTTQEQLETIKDLKSKIARLRPQDTQQTQEFDNSEKKKSVLLLEIEKLQKENNELKLKTQDA 295
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124448433  296 SKHKMSLQNLQSKNTTLTEKYAELKHNSNDLNFKYDKLLREKQELEEKFERI----AMEVKKHTDLQNNVLGQQLQNMQD 371
gi 121982066  298 AKHKMSLQNLKSKAITLKDKITKLERDGKDLDEKYEKVVREKQELEKKFEDI----TQEVKKNADLNNNVLSNRLQILLK 373
gi 74862658   300 SKDFVIYKNLELIYNESDVHIKNLKQFSQSSRDKITQVEKELKRISEDELN-----VDDYFEDIKKKNILLKKKIESIDI 374
gi 74988167   132 SKDFVMYKNLELIYNENNVYIKNLKVFSHSFKEKILQVENAFIDLSKNENDG----FDDYFENIKNKNMCLKNKIKSLNL 207
gi 1005162325 307 VKDKMALQNIRARDTQLEEKVKAAKKHNHQMEQQKHKLERDIGEYTRRLRNL----QSDTSLRTQAKIMLYEQKVRQMLK 382
gi 123410632  337 KRAKSKLAQNKSKIKVLEEEKRNLQLAQEVLEQRFEQLEQERDALYDQFETS----IHDVRQRTEFRAFILEQKVQKMHE 412
gi 123487900  297 DSDKMALQNSKNMIESLTAEIDSLKHQHSVKLAKFKKMEQEKEQLLEKFEAS----VHDVKQKTEFRALLLEKRVETLGE 372
gi 901875885  299 SKDFVIFKNLELIYNESNMYIKNLREFAQNSKEKISQVEEAFQELPQGDDQNgdayFEGYFEDIKNKNRLLKKMVQNIDL 378
gi 569425846  148 HK---SLKASKTRLSVLDERLRDTISDFENLKHEFEALQQSKKELQKSHEDD----VNTMTDDFEKRKTDQIQKILLLQQ 220
gi 123481334  296 DKLSAELKKVTEVVEELEDEKENELIADEVLSKRFEQLEEERNAMYDQFEAM----IKDVHQKAEFRGYILAQKIQKMNE 371
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 124448433  372 GLEEKEVQLKTIVERVNMDPQMYQQLTIKIKESIEAKNQLVKNL 415
gi 121982066  374 EYNNKEEELRTIIDNAGLDHNLHEQLKQRVQQSIEAKNTLIKNL 417
gi 74862658   375 NLDDINKEFQSYIKENNIKDEDVQNVRKGINFCLNTYNREFDNL 418
gi 74988167   208 NLESLDKELNLYIKEKGIKQEDVITVRKGIDFCMRTYNKEFDNL 251
gi 1005162325 383 SLEHKFREREQLVASLKLSPEASMHIVELLRRSFCEKNDEIETL 426
gi 123410632  413 VLEQKEMQLQQVMQRKGLDATA---ISAKIEDVMAVKNARINQL 453
gi 123487900  373 VLKKKEGSLEEMIETSEIPQDQVQAIAEQVADLLRAKNAVIDNL 416
gi 901875885  379 DMDAVNKELTSYINSHHLRDDDVQKVRQGINFCMQTYNKEFDNL 422
gi 569425846  221 QTDQQEKRVDELVKQQNIDTLTLSNWSEELKQTLKDKNQEIEYL 264
gi 123481334  372 MLDSKERQLQTSIAKGSV----GNAMQVKIDQALAEKNSRINQL 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap