5LVV


Conserved Protein Domain Family
Glyco_transf_41

?
pfam13844: Glyco_transf_41 
Glycosyl transferase family 41
This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
Statistics
?
PSSM-Id: 404688
Aligned: 13 rows
Threshold Bit Score: 1015.4
Created: 21-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LVV_A        179 VCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKI--NVLHKPPYEHPKDLKl-S 255  human
ESN92123      477 VCDWSDYDSRMKKLVNIVQDQLDKNRLPSVHPHHSMLYPLNHSQRKGIAARHAALCLEKI--SILHKEPYVFPKDLSs-S 553  Helobdella ro...
CRZ23507      537 ICDWNDYDNRMKKLIAIVDDQLQKKRLPSVHPHHSMLYPLTHAVRMAIAAKHAQLCIEKV--QICHKAPYIYPDRNSvrK 614  Brugia malayi
CAP34526      613 ICDWTDYDKRVRRLVQLVEDQLGKKRLPSVHPHHSMLYPLSHATRIAIAAKHASLCFDKVhlQMLGKTPLIHADRFSvqN 692  Caenorhabditi...
XP_015787020  481 ICDWTDYEARMKKLVAIIREQLEKNRLPSVHPHHSMLYPLSHDFRKAIAARHAALCLEKI--QVLHKPPYQFKFGKV--- 555  two-spotted s...
EFX74619      478 VCDWTDYETRMKRLIHIVGEQLERNRLPSVHPHHSMLYPLSHEYRKAIAARHANLCVEKI--LILHKANFKYPKELA--T 553  common water ...
XP_008178299  478 VCDWTDYESRMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHNFRKAIAGRHAALCLEKI--QVLHKPPYNYTKDLA--P 553  pea aphid
XP_001846338  276 VCDWTDYEARMKKLVAIVADQLDKNRLPSVHPHHSMLYPLSHDFRKAIAARHANLCLEKI--NILHKPPYKFTRELT--- 350  southern hous...
EDV25169      455 ICDWADYELRMKRLVSIVQDQLEKGRLPSVHPHHTMLYPLDGHTRKAISNRHGNLCLDRT--ATIHKPPYKFTPNIIl-P 531  Trichoplax ad...
XP_003386934  496 VCDWSDYESRMKRIVQIVGEQLAKNRLPSVHPHHSMLYPLSHGQRKGIAARHATLCLEKV--STLHKAPYQYPKDRSa-S 572  Amphimedon qu...
XP_011672883  466 VCDWTDYESRMKRLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAARHGNLCLEKI--TVLHKPAFNHPQDLTa-S 542  purple sea ur...
XP_009858570  480 ICDWSDYDERMKKLVSIVSDQLSKNRLPSVHPHHSMLYPLTHDFRKAIAARHGALCLDKI--NILHKPAYDHPRSLAp-T 556  vase tunicate
XP_018650269  486 VCDWSDYKHRMKKLVSMVQDQLESNRLPSVHPHHSMLYPLTHDQRKKIAGKHASLCLEKV--SLLHHQPFRFSKKLP--A 561  Schistosoma m...
5LVV_A        256 DGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDG 335  human
ESN92123      554 GGRLRIGYVSSDFGNHPTSHLMQSVPGFHDREKVEVFCYSLSPDDGTTFRGKVSSEAEHFIDLSKYPCNGKAADLIHEDG 633  Helobdella ro...
CRZ23507      615 GQRLRIGYVSSDFGNHPTSHLMQSIPGMHNRENVEVFCYALSPNDGTNFRQKLMNESEHFVDLSQITCNGKAADRIHDDG 694  Brugia malayi
CAP34526      693 GQRLKIGYVSSDFGNHPTSHLMQSIPGMHNRERVEVFCYALSVNDGTNFRSKLMAESEHFVDLSQITCYGKAAERIAQDG 772  Caenorhabditi...
XP_015787020  556 -DRLKVGYVSSDFGNHPTSHLMQSVPGFHDRENFEIFCYALSPDDGTTFRSKIAGECDHFVDLSTVSCNGKAADMIFEDG 634  two-spotted s...
EFX74619      554 NGRLRIGYVSSDFGNHPTSHLMQSVPGFHERSRVEIFCYSLSPDDGTTFRAKIARESEHFVDLSQIICNGKAADRINADG 633  common water ...
XP_008178299  554 GNRLRIGYVSSDFGNHPTSHLMQSIPGLHNKEKVEIFCYALSTDDTTTFRSKIAREAEHFIDLSNIPCNGKAADKINSDG 633  pea aphid
XP_001846338  351 -GRLRIGYVSSDFGNHPTSHLMQSIPGMHDRSKVEVFCYALSPDDGTTFRSKISRETEHFIELSQIPCNGKAADRIHADG 429  southern hous...
EDV25169      532 NGKLKIGYVSSDFGNHPTSHLMQSIPKLHDRSRVEVYCYSLTADDGTSFRKEISRGSDHFVDLSQVQCHGDAADRINADG 611  Trichoplax ad...
XP_003386934  573 GGRLRIGYISSDFCNHPTSHLMQSVPGFHNRAKVEVFCYSLSPDDNTSFRRKIAQESEHFIDLSKVPDNGAAANRINSDG 652  Amphimedon qu...
XP_011672883  543 GGRLRVGYVSSDFGNHPTSHLMQSIPGKHSKDMVEIFCYALSPDDNTSFRSKAMKEAEHFVDLSQIQCNGKAADRISADG 622  purple sea ur...
XP_009858570  557 NGKLRIGYVSSDFGNHPTSHLMQSIPGVHDLSKVEVFCYALSPDDNTNFRKKVSNEVANFVDLSQIQCNGKAADRIHQDG 636  vase tunicate
XP_018650269  562 GQRLRIGYVSSDFCNHPTSHLMQSIPGLHDRTKVEVFCYSLAPDDGTNFRAKVANEAEHFVDLSGIQCHGKAADKIASDG 641  Schistosoma m...
5LVV_A        336 IHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVA-EQYSEKLAYMPHTFFIGDHANM 414  human
ESN92123      634 IHVLVNMNGYTKGARNEIFALKPAPIQVMWLGYPGTSGASFMDYIVTDATTSPLENAeEQYSEKLAYMAKTFFIGDHRQM 713  Helobdella ro...
CRZ23507      695 IHILINMNGYTKGARNEIFALRPAPIQVMWLGYPSTSGAPFMDYIITDSVTSPLELA-HAYSEKLAYMPHTFFIGDHAQM 773  Brugia malayi
CAP34526      773 IHILINMNGYTKGARNEIFALRPAPIQVMWLGYPSTSGATFMDYIITDAVTSPLRLS-CAFTEKLAYMPHTFFIGDHAQM 851  Caenorhabditi...
XP_015787020  635 VHILVNMNGYTKGARNEIFALKPAPIQVMWLGYPGTSGAPFMDYIVTDKITSPVELA-SQYSEKLAFMPDTFFVGDHKNM 713  two-spotted s...
EFX74619      634 IHILVNMNGYTKGARNEIFAMRPAPIQVMWLGYPGTSGASYMDYIITDRVTSPLELA-SQFSEKLAYMPKTFFVGDHRQM 712  common water ...
XP_008178299  634 IHILVNMNGYTKGARNEIFALRPAPIQVMWLGYPGTSGAPFMDYLITDMVTSPIELA-SQYSEKLAYMPHTYFVGDHRQM 712  pea aphid
XP_001846338  430 IHILVNMNGYTKGARNEIFALRPAPIQVMWLGYPGTSGASFMDYIVTDSVTSPIELV-DQYSEKLAYMPHTYFIGDHRQM 508  southern hous...
EDV25169      612 IHILLNMNGYTKGARNEIFALRPAPIQMMWLGYPGTSGAAFMDYIITDKITSPMEYA-DHYSEKLAFLPNSFFIGDHRHM 690  Trichoplax ad...
XP_003386934  653 IHVLVNMNGYTKGARNEIFALKPAPVQIMWLGYPGTSGASYMDYIITDRVTSPMNLA-DQYSEKLAYMPRTFFVGDHRYM 731  Amphimedon qu...
XP_011672883  623 IHVLVNMNGYTKGARNEIFALRPAPIQVMWLGYPGTSGASFMDYLITDSVTSPMELA-SQYSEKLAFMRHTFFIGDHWNM 701  purple sea ur...
XP_009858570  637 IHILLNMNGYTKGARNELFSLRPAPIQAMWLGYPGTSGATFMDYIISDAVTSPLELR-DQYSEKLAYMPNTFFIGDHAQM 715  vase tunicate
XP_018650269  642 IHILLNMNGYTKGARNEIFALKPAPIQAMWLGYPGTSGSTFMDYIITDMVTSPMHLS-HQYSEKLAYMPKTFFIGDHQQM 720  Schistosoma m...
5LVV_A        415 FPHLKKKAVIDFKsnG-H-----------------IYDNRIVLNGIDLKAFL--DSLP----DVkIVKMKCPD--GGDNA 468  human
ESN92123      714 FKHMTKKAILTTK--EkNe----------------TRDNIMLVNAMDFTPLR--ALGT----VK-EVKQVCWSdkERGSG 768  Helobdella ro...
CRZ23507      774 LKHLTERVIVKEKndPtPi----------------DKETVTVVNSVNLEPLL--SKAE----VKpFVREAEVA--HGPER 829  Brugia malayi
CAP34526      852 LRHLTEKVVVKDKdaT-------------------ERDSSLIMNTANMDPIL--AKSE----IKeQILDTEVV--SGPKK 904  Caenorhabditi...
XP_015787020  714 FPHLIERVILTTEtnGlKkhnhnysssqsalvneaPPDNVAIVNATDLSPIM--EKVE----VK-KVKEITVVstQ-SLA 785  two-spotted s...
EFX74619      713 FPHLKERLIITSSsdKgK-----------------VADNVALVNGTDLSPIL--ERTE----IK-KVTEVVTPttT--TG 766  common water ...
XP_008178299  713 FPHLSERIILCDKvtCrKd----------------MADNVAVINAADLSPII--ENTN----VT-EIKQVIMSelT-DSK 768  pea aphid
XP_001846338  509 FPHLKERVIVSGKsqSnQ-----------------LVDNVAVINATDLSPLV--ENTD----VK-TVREVVHAnkT---- 560  southern hous...
EDV25169      691 FAHLSVRATDN------------------------GRDRVINLSEGSAPDLD----------MKdIIEAQLREalSKIDN 736  Trichoplax ad...
XP_003386934  732 FPHLLFKG----------------------------------QGTTDPAPLQaiDSQSgvtsINsVIQRPVHSitGGNRQ 777  Amphimedon qu...
XP_011672883  702 FPHLLDKAIVEVKsgS-------------------SRDNVAVINSINLKATL--EKLG----VSdKVAT--------NGE 748  purple sea ur...
XP_009858570  716 FPHLKEKAVIDVKgaGdGd----------------VSDNCCVLNSTDMKDTL--DWFGgisyLSsKVKD----------- 766  vase tunicate
XP_018650269  721 FPHLRNRVILESAedAtAgr--------------rVTDNSIVVSGLDIKPLL--QVAC----VReVTYGGRLVeiHGSQR 780  Schistosoma m...
5LVV_A        469 DSSNTALNMPVIPMNTiAEAVIEMINRGQ----------------------------IQITIN-GFSISNGLATT-QINN 518  human
ESN92123      769 DSSTPEVVTEVIELPT-LEPILSMIENGQ----------------------------PQCTID-EVVIQNGVTTN-QTNN 817  Helobdella ro...
CRZ23507      830 DMIKTEVVLPVIEVPT-TEPLKQMIGSGM----------------------------IAGNVE-GVPVQNGLTTLnQTHV 879  Brugia malayi
CAP34526      905 ELVKAEVVLPVLEVPT--EPIKQMIMTGQ----------------------------MTMNVMeDVNVQNGLGQS-QMHH 953  Caenorhabditi...
XP_015787020  786 NFEKIEVVKKMVELPT-TSAVSVMISTGQ----------------------------LSTSVN-GIVVQNGLATT-QLNN 834  two-spotted s...
EFX74619      767 LDAPVQVSLTVAQLTT-MDPIETMIGSGQ----------------------------VQTSVN-GVVVQNGLATN-QANT 815  common water ...
XP_008178299  769 QTRPVEVNFKFAELPT-TTPIETMIASGQ----------------------------AQTSVN-GVVLQNGLAVVdNGNN 818  pea aphid
XP_001846338  561 ----VEIQHKIVELPT-TTPVETMIASGQ----------------------------IQTSLN-GVVVQNGLATT-QTNN 605  southern hous...
EDV25169      737 TSSHINTSTNLISNGT--LGSNAVIPNGG----------------------------PIINGN-GDSVPNGPGVN----- 780  Trichoplax ad...
XP_003386934  778 ASSTQALQQQKLAL---QQQKSLLIQQHQsclhnlqqqphnhlylqqcqqsqqalqkIQASLN-QLSQQTAIASTpQPEH 853  Amphimedon qu...
XP_011672883  749 VSNGEKLHFPVIESST-SQALHSLIQSGQ----------------------------VQGTIN-GITVCNGLALT-QSIP 797  purple sea ur...
XP_009858570  767 -EEDKEVVTPVVPLNKsAHNICSMIKNSQ----------------------------LTVQLDeSHTAQNGLALV-QIDA 816  vase tunicate
XP_018650269  781 KDVSYFTKLTVLTIPS-LQPIQNMIRTNS----------------------------PSCTIN-GVTIHNGLVTQ-QTQS 829  Schistosoma m...
5LVV_A        519 KAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNM-G 597  human
ESN92123      818 KCASGEQTQSAIIVSARKQYGLPDDAIVYCNFNQLYKIDPPTLDMWMNILKAVPNSVLWLLRFPAVGEPNVHQTAINK-G 896  Helobdella ro...
CRZ23507      880 KAATGEEVPHTILVTSRQQYGLPDDAIVFCNFNQLYKIDPPTLSMWCDILKLVPNSILWLLRFPYHGEPNVMRFCAER-N 958  Brugia malayi
CAP34526      954 KAATGEEIPNSVLLTSRAQYQLPDDAIVFCNFNQLYKIDPPTLDMWIKILENVPKSVLWLLRFPYQGEEHIRKYCVER-G 1032 Caenorhabditi...
XP_015787020  835 KAATGEEAPKSIVVTSRQQYGLPEDAIVYCNFNQLYKIDPPTLTMWVNILKRVPNSVLWLLRFPAHGEPNILAMAEEL-G 913  two-spotted s...
EFX74619      816 RAATGEEVPQSIVVTTRQQYGLPDDAIIYCNFNQLYKIDPPTLQMWVNILKRVPNAVLWLLRFPTVGETNMLATAQAL-G 894  common water ...
XP_008178299  819 KAATGEEVPQNIVITSRQQYSLPEDAVVYCNFNQLYKIDPNTLLMWVNILKAVPNSVLWLLRFPAVGETHIQSTAASL-G 897  pea aphid
XP_001846338  606 KAATGEEVPQNIVVTTRQQYGLPDDAVIYCNFNQLYKIDPHTLTSWCNILKHVPNAVLWLLRFPAVGEANIQAAAQQL-G 684  southern hous...
EDV25169      781 -------VPSGMVLTTRAQYGLPSKAIIYCNFNQLYKIDPKILETWVRILKRVPNSILWLLRFPAAGEAMLKNTILKM-G 852  Trichoplax ad...
XP_003386934  854 PLA----MPTDLPLTTRAQYGLPEGAVVYCNFNQLYKIDPATLESWANILKRVPNSIMWLLRFPAVGEPNVVATTQKL-G 928  Amphimedon qu...
XP_011672883  798 KSATGEEVPSYPLITTRNMYGLPDDAIVFCNFNQLYKIDPATLRMWVNIIQKVPNSVLWLLRFPAAGEPHLLATATQL-G 876  purple sea ur...
XP_009858570  817 KAATGEKPPSGIIVSSRSQYRLPNNAIVFCNFNQLYKIDPSTLIMWCNILKRVPNSVLWLLRFPAVGEANVKKFARQTcG 896  vase tunicate
XP_018650269  830 KASAGEEVPRDLILTSRQHYGLPEDAVVFCNFNQLYKVDPSTMRMWVEILKGVPNSVLWLLRFPAAGEAGALAAASEM-G 908  Schistosoma m...
5LVV_A        598 LP--QNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKN 675  human
ESN92123      897 IA--PERVIFSPVAPKEEHVRRGQLADICLDTPICNGHTTGMDVLWAGTPMVSLPCDTLASRVASSQLMTLGCPELVAKD 974  Helobdella ro...
CRZ23507      959 ID--TRRIVFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTGMDILWTGTPMITMPLETLASRVASSQLYALGVPELVAKD 1036 Brugia malayi
CAP34526     1033 IE--PSRIVFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTGMDILWTGTPMVTMPLESLASRVATSQLYALGVPELVAKT 1110 Caenorhabditi...
XP_015787020  914 LP--SHRIVLSNVAAKEEHVRRGQLADLCLDTPLCNGHTTGMDVLWAGTPMITLAGETLASRVASSQLACLGVPDLIARN 991  two-spotted s...
EFX74619      895 LG--SGRILFSNVAAKEEHVRRGQLADICLDTPLCNGHTTGMDVLWAGTPMVTLPGETLASRVAASQLTTIGCPELIASS 972  common water ...
XP_008178299  898 IE--PGRILFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTSMDVLWTGTPVVTLPGETLASRVAASQLATLGCPELIART 975  pea aphid
XP_001846338  685 VA--PGRIIFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTSMDVLWTGTPVVTLPAETLASRVAASQLATLGCPELIARS 762  southern hous...
EDV25169      853 LP--ADRVVFTNVAPKEEHVRRGQLADICLDTPMCNGHTTGMDVLWAGVPMITMPKETLASRVASSQLTSLGVSELIAKD 930  Trichoplax ad...
XP_003386934  929 IQ--PSRIIFSPVAPKEEHVRRGRLADMCLDTPLCNGHTTGMDVLWAGTPVLTLPLETLASRVAASQLISLGFPELVASS 1006 Amphimedon qu...
XP_011672883  877 MP--KGSLVFSAVASKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMITLPGETLASRVAASQLQTLGCPELIASS 954  purple sea ur...
XP_009858570  897 IN--ANRIIFSPVAPKEEHVRRGQLADICLDTPLCNGHTTAMDVLWAGCPMVTLPKETLASRVASSQLACLGCPELIAEN 974  vase tunicate
XP_018650269  909 LQqvNRRILFSNVAPKEEHVRRGQVADVCLDTPLCNGHTTGMDVLWAGCPVVTLPLETLASRVAASQLHTLGCPELVANS 988  Schistosoma m...
5LVV_A        676 RQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMEL 719  human
ESN92123      975 RPDYERIAIKLGTDMEFLLKMRAKVWFLRTASELFDVQAYTACM 1018 Helobdella robusta
CRZ23507     1037 REDYIKIAKRLGTDREYLSQIRAKVWKARTTSTLFNVRQYCSDM 1080 Brugia malayi
CAP34526     1111 RNEYVQIATRLGNDAEHLASMRAKVWMARTTSTLFDVKQYCHDM 1154 Caenorhabditis briggsae
XP_015787020  992 RQDYEDIAVKLGTDRQYLKAIRAKVWKARAESPLFNVKIYTSNL 1035 two-spotted spider mite
EFX74619      973 PQEYEDIAVKLGTDSEYLKAIRAKVWIRRSDSPLFNCQIYAHDM 1016 common water flea
XP_008178299  976 REEYQDIAIRLGTDKEYLKTMRAEVWRARSESPLFNCSIYTNGL 1019 pea aphid
XP_001846338  763 RQEYQDIAIKLGTDKEYLRAIRAKVWVARCESPLFDCKQYAQGL 806  southern house mosquito
EDV25169      931 LTEYEDVAVKYGSDITRLRKLQDKIWQLRHKSTLFNTKTYCQNL 974  Trichoplax adhaerens
XP_003386934 1007 RQEYEDIAVTYGNNPAKLKALKTRVQDARLTSSLFDTKKYTQDL 1050 Amphimedon queenslandica
XP_011672883  955 KQEYEDIAIRLGTDIKFRQHIRAKVWRRRVESPLFNTKMYAQSL 998  purple sea urchin
XP_009858570  975 SQQYEDIAVRLGTDMDYLKSVRAKVWHRRSTSPLFNVKRYVSDL 1018 vase tunicate
XP_018650269  989 QEDYVRIATKLGNNREYLQAMRAKVWKARESSALFSCRSYTADI 1032 Schistosoma mansoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap