Conserved Protein Domain Family
DUF4168

?
pfam13767: DUF4168 
Domain of unknown function (DUF4168)
Statistics
?
PSSM-Id: 379360
View PSSM: pfam13767
Aligned: 104 rows
Threshold Bit Score: 33.6672
Threshold Setting Gi: 427996200
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Oscil6304_1481  45 SDEDLDKFSRAIFQMLTIEQQFQERIvQTIEGQgfsqerfaeiyqanvqaqenpaaqaelnispeeqqkfaqimEEGKQI 124 Oscillato...
Q2JHR1              53 SDEQVTMYARIVLEMEPHRQEAQKRS-QATNDP-----------------------------------------ASKDQI 90  Synechoco...
WP_006459883        38 SDADVDLFAQSIINVENLKQKYQMDLmQMPEAEvt--------------------------------------eQLLEEV 79  Thiomicro...
Q2JIP9             187 SSEQIDRFARTLLAVQPLLESTQNRL-QQANSS-----------------------------------------EERRQI 224 Synechoco...
Q2JI54              61 TDAQVEQLVRILLELDPLIREASAQL-RETQNE-----------------------------------------EEYEQI 98  Synechoco...
EKQ68366            33 pSEKVSQFVHACLQVVTLIERREGDL-QAAETE-----------------------------------------AESTQI 70  Oscillato...
jgi:Oscil6304_4727  73 psvKVSQFVGAYLQVLHQIEGRQQEL-LSASTS-----------------------------------------LESQRI 110 Oscillato...
jgi:Syn6312_1993    53 SAEKISQFAQAYRQVIALIDSREAEL-RSAETQ-----------------------------------------AEALQI 90  Synechoco...
jgi:Cyan7425_4967   47 SSEKVSQFVQAYLQVLALIEQREGML-QGAETQ-----------------------------------------PEAQQV 84  Cyanothec...
jgi:GEI7407_0333    63 pSEKVSQFVRAYLAVVSLVEAREGEL-QSAETE-----------------------------------------VEYQRL 100 Geitlerin...
jgi:Oscil6304_1481 125 QEESQARQEQAIASLGLNMDRLNEIGSAIQQNP--QLQQE 162 Oscillatoria acuminata PCC 6304
Q2JHR1              91 RREFIRTATEIITRHGMTVPDYNRITLLIRSEEgkALQQR 130 Synechococcus sp. JA-2-3B'a(2-13)
WP_006459883        80 NARFEQEAIALIEKEGMSVEKYGEMIGLLQQNP--EFLAK 117 Thiomicrospira aerophila
Q2JIP9             225 EQQFEAAAAEIIVAHQLTPEDYQRISASAQLDP--QVAAA 262 Synechococcus sp. JA-2-3B'a(2-13)
Q2JI54              99 MQRTETQASRIVEEQGLTVLQYRELMTLANENP--VLNQR 136 Synechococcus sp. JA-2-3B'a(2-13)
EKQ68366            71 EQEIEAEALAIIEKAGLTRQEYLQLLGLANTDP--EFGER 108 Oscillatoriales cyanobacterium JSC-12
jgi:Oscil6304_4727 111 EREIESASITAIEQAGLTKQEYLQMLSLANIDP--EFGER 148 Oscillatoria acuminata PCC 6304
jgi:Syn6312_1993    91 EQDIETAAITTIEATGLTGPEYLQLLGLANTDP--ELSQR 128 Synechococcus sp. PCC 6312
jgi:Cyan7425_4967   85 EREIAAAALEMLEENGLTWQEYLQLLGLANSDP--EFGER 122 Cyanothece sp. PCC 7425
jgi:GEI7407_0333   101 AQAIHTEAMATIRSADLTPQEYLQLLELAKVDP--DFGER 138 Geitlerinema sp. PCC 7407
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap