Conserved Protein Domain Family
VIT_2

?
pfam13757: VIT_2 
Vault protein inter-alpha-trypsin domain
Inter-alpha-trypsin inhibitors (ITIs) consist of one light chain and a variable set of heavy chains. ITIs play a role in extracellular matrix (ECM) stabilisation and tumor metastasis as well as in plasma protease inhibition. The vault protein inter-alpha-trypsin (VIT) domain described here is found to the N-terminus of a von Willebrand factor type A domain (pfam00092) in ITI heavy chains (ITIHs) and their precursors.
Statistics
?
Aligned: 7 rows
Threshold Bit Score: 115.205
Threshold Setting Gi: 1002953860
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015699912   16 WFLGPTSQRNLLPQVDLKVHSTILSASSRTTLTQTFINPTPGELKDVkYTFPLVDGVSAVEFTCEIGNRVIRGIVKERE 94   Paracoccidioid...
EDO37524        2 TGLVNRHTSYPLQLKASSIFAEVNGFAARVLATLTYYNQCEYDVEGL-FVFPQDERTTVVELEATVEERHVYTDIRAQT 79   starlet sea an...
EEN57170        2 PGLINIHSRTRIPLQASRASACLIGYSLGLTASLTYYNDQDVPVDAM-FVYPVDESCVVVGFEALVGGRTISLQLKDGP 79   Florida lancelet
EEN57173        2 PRLLNWATRTRVPLKSVRISACMMGHSLGMTSSFSYYNDQDYPLEVA-FIYPLDNKTTVVGFDAMIAGRTIGVQLREKK 79   Florida lancelet
Q8N398          2 PGLYCPSSWTPLPLTDSWVRACANGPCLSVRARLTYRNPQPQPVDGV-FVYPLAEAEVVSGFEAEAAGRRVSFQLQSRR 79   human
Q5TIE3          2 PGLLNWITGAALPLTASDVTSCVSGYALGLTASLTYGNLEAQPFQGL-FVYPLDECTTVIGFEAVIADRVVTVQIKDKA 79   human
XP_003975658    2 VGLRNCSTWEPLLLKSSCIKSCANGCSLGITAHLTYANADTESVEGV-FVYPLGEKEVVVGFEAAIAGRLLGVQIQSRg 79   torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap