Conserved Protein Domain Family
DUF4164

?
pfam13747: DUF4164 
Domain of unknown function (DUF4164)
This is a family of short, approx 100 residue-long, bacterial proteins of unknown function. There is several conserved LE/LD sequence pairs.
Statistics
?
PSSM-Id: 316283
View PSSM: pfam13747
Aligned: 20 rows
Threshold Bit Score: 58.0876
Threshold Setting Gi: 501274168
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0BWL5         6 NLMNEMDSAATRLDAALKRLEGALEAHLTRAGDP--AALRAEITALVEDRSRLAEELDDALAREQELQALADEASDALGA 83  Hyphomonas nept...
Q2GH64         2 NQINNNSEFQQNLDKAFDRLESLLIQKLNNKNNI--SQYKATIELLTEEKNKLDQQLTNKTNECNSWKEICHETIHRLNS 79  Ehrlichia chaff...
WP_014286950   7 dsgQDLDQALDRISASITKLEGALHRRTSRDKTL--DALENDLQRIGEDRTQLAAKLDQAEARGSRLEDVNKDVSRRLVA 84  Pseudovibrio
ACB97026       2 HLSEELAESLKRIEAILDRLEAASERRLRQDQAR--GDIAAELRLMQDDRSRLAVELDQALARNEALANAQAEVSQRLQS 79  Beijerinckia in...
WP_003602920  14 qdgvgLEEALHRLDTALALLETAVARKLEAERSR--GDRETEFALLEEDRVRLAAELDAAGARLARMNSTTGEVNRRLDR 91  Methylobacterium
WP_012591282   2 DIPQRLDDALKRLSASLEKLEAASDRRAKSDAMR--ANLEEELAVLQDDRSRLAVELDGAIARAVTLEGANEDIARRLKS 79  Methylocella si...
WP_012317186   5 TETISIDDALSRLEAAITRLDAVVQHRLETDAQP--DDRDAELALMDEDRARLAAALDAASARLAAVSATTGEVGHRLDR 82  Methylobacteriu...
WP_012564439  30 SPADKIAAATRRLAAALDAMESAVERRREYDRGS--DELAARIQALGIDRSRLANELDGTLVRSRELERTNREIAERLDV 107 Oligotropha car...
BAF86504      22 PELGPIEAATQRLHAALDRLSDSLDRRRETERHQ--EALQAQLHALGNDRARLAAELDATRAEAAQVAEASREIGRRLDV 99  Azorhizobium ca...
WP_037348940   2 VVKSEDADYAGDLRRAFDELEDSLTRRLGAEGGTgtAGSERRVSELAAEKQLLEEALMQREAECAYWKATCSEIVDGLNS 81  Anaplasma margi...
Q0BWL5        84 AIQEVRAALSP 94  Hyphomonas neptunium ATCC 15444
Q2GH64        80 TIENIKAILKR 90  Ehrlichia chaffeensis str. Arkansas
WP_014286950  85 AMESIRTVLEG 95  Pseudovibrio
ACB97026      80 VGTSLQTILAR 90  Beijerinckia indica subsp. indica ATCC 9039
WP_003602920  92 AIETVEDVLSG 102 Methylobacterium
WP_012591282  80 ANAAIRDILGE 90  Methylocella silvestris
WP_012317186  83 AIETVQDVLGR 93  Methylobacterium radiotolerans
WP_012564439 108 AIGTIRSVIEE 118 Oligotropha carboxidovorans
BAF86504     100 AMTTIRDVLAT 110 Azorhizobium caulinodans ORS 571
WP_037348940  82 SIEAVKSILNG 92  Anaplasma marginale
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap