Conserved Protein Domain Family
zinc_ribbon_5

?
pfam13719: zinc_ribbon_5 
zinc-ribbon domain
This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR, pfam12773.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 63.4195
Threshold Setting Gi: 296015564
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Ppro_0024   1 MIIQCEQCRTKFRLDDSKIKENGVKVRCAKCRHVFTV 37  Pelobacter propionicus DSM 2379
Q12EI8          3 LITRCPACGTMFKVVTDQLKVSQGWVRCGHCAEVFDA 39  Polaromonas sp. JS666
jgi:Plim_2981   4 LRISCPDCDSTFKLASSE--KLGKKVKCAKCGSIFVA 38  Planctopirus limnophila DSM 3776
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap