Conserved Protein Domain Family
RCC1_2

?
pfam13540: RCC1_2 
Regulator of chromosome condensation (RCC1) repeat
Statistics
?
PSSM-Id: 379248
View PSSM: pfam13540
Aligned: 181 rows
Threshold Bit Score: 29.3045
Threshold Setting Gi: 262077668
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEH51789     269 ASSVAAGREHTVVLTREGD-VYAWGDDGVGQ 298  Micromonas pusilla CCMP1545
EER10284     467 VKTIACGSQHVLFTCHETElCFAWGSNSMGQ 497  Perkinsus marinus ATCC 50983
XP_001615548 243 IASVSCGQSHALFLAQNKN-CYAMGSNDCYQ 272  malaria parasite P. vivax
Q8IHT1       253 IESISCGKDHTLFLSRDKN-CYAMGCNQFYQ 282  Plasmodium falciparum 3D7
EFC39364     148 IVKIACGYQHCMILTRDGT-MIGTGCSYQRQ 177  Naegleria gruberi
EFC39372     195 LEKISCGYQHAIAYSKDGN-LYGTGCSFQNQ 224  Naegleria gruberi
EFC48725     149 FSHASFGSSHSLILSESGN-LYTTGSNTYGQ 178  Naegleria gruberi
XP_002677616 175 IKKIDCGSNHSAVLLENGK-LFIFGSNQKNQ 204  Naegleria gruberi strain NEG-M
XP_002676859 289 IAKVVCGEKHSAVLTVDGE-LFMTGKNSELQ 318  Naegleria gruberi strain NEG-M
XP_002680415 189 IVDIALGDGHTLFLSENGN-LYGYGSNTAGQ 218  Naegleria gruberi strain NEG-M
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap