Conserved Protein Domain Family
ATP-grasp_4

?
pfam13535: ATP-grasp_4 
ATP-grasp domain
This family includes a diverse set of enzymes that possess ATP-dependent carboxylate-amine ligase activity.
Statistics
?
PSSM-Id: 316093
View PSSM: pfam13535
Aligned: 18 rows
Threshold Bit Score: 153.978
Threshold Setting Gi: 212560347
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TPB8       121 IKKPFIIKPAVGFFSLGVYKVSTDEDWAPVIKRIKAEVEEIKGRYPVQVLD-VGNFIIEENIEGEEFAVDAYFNSAGKPV 199 Methanosarcina ...
WP_012875107 146 SFYPCVIKPVSLAASRGVIKANNPTEFIEAFSRIRNML-------LEDGSDpSTQILVEEYVPGFEIAVDGLL-TNGELT 217 Thermobaculum t...
WP_012871610 148 VNYPCVVKPTILSGSRGVIRADDPDQFVAAFARTRDI--LASEGWAP---E-AASILVEEFLPGFEVALEGLLTENGLQV 221 Sphaerobacter t...
WP_014370894 147 IGYPVVLKPTNCASSQGVYFINREEELREAFAQLQ----QFKVTYMDFKV--REEYLVEEYIGGPEFSVELFL-QEGTPV 219 Paenibacillus m...
EKD75377     143 IGFPCIIKPVDQSGSMHVSKINNLAELSAAYHAMCND--PWTEMGK-G--I-GSVALIEEYINGEEFSVEGYVDNQ-YTQ 215 uncultured bact...
WP_015120438 128 EVENVVLKPSLGTASIGIRTIKGQQEWGKAVDSVLKDIDVAKEHMNPAMLN-DASFLVEEFVDGDEFACDGFWDSNGKTV 206 Rivularia sp. P...
CCZ51399     122 IRFPVVLKPSVGFLSFGVHTIKESKEWKDVISQLEKEMRMAAMMYPNHVVN-STKFLIEEMIEGEEYAVDAYFDRDGEPV 200 Acinetobacter s...
WP_012765876 121 LPIPCVIKPSVGFFSLGVHMVESIEGWHQAVDEIKNEVEQIKTMYPAKVLE-LDNFIIEQCIEGEEFAVDAYFDKEGNPV 199 Desulfovibrio s...
WP_015902940 121 LPLPFIIKPIVGFFSMGVYKVSNIHEWGNAIEAIRTEIDQVKNLYPQEVMD-PSAFIIEQCIDGDEFAVDAYFNSLGEPV 199 Desulfobacteriu...
ACA41642      73 LPFPIIVKPVIGYSSVGVHRIDKVEEYKETIEQLKFEMEVTSAEYPIEVIN-NQSFIIEKLIEGDEYAVDVYFTEEGEPV 151 Lysinibacillus ...
Q8TPB8       200 VLDILKHIFSSEND-VSDRV-YFTSKAVMETYRETV-EDLLKEIGKLAGLKNFPLHIEIRIGEDR-RIQPIELNPMRFAG 275 Methanosarcina ...
WP_012875107 218 LIAIFDKPDPMEGPfFEETI-YVTPSRLSPNIQGRV-VNLIQLASKAIGLKHGPIHAELRVNDDS--IHLIEIAARAIGG 293 Thermobaculum t...
WP_012871610 222 LALFDKPDPLDGPF-FEETI-YVTPSRLPEETQAAI-AETTARGAAALGLRQGPIHAELRINERG-PWI-IEMAGRSIGG 296 Sphaerobacter t...
WP_014370894 220 FAAVTEKRTSPLPY-FVEVL-HTLPTSVHRESEAALiDTAVSALK-AIGLVNGPSHVEVKLSADGpRIIEV--NGRPGGD 294 Paenibacillus m...
EKD75377     216 IASIT-KKFLTPEP-LFIEMgHIVPADITLEKQKII-KQYVKEVIAALNINLGVFHAELRIDEEG-PVLM-EI-AGRLAG 289 uncultured bact...
WP_015120438 207 ITGIYQHPFASSLD-VSDTV-YYTSTKVLAQTIEPT-MQVLEHIGAKLGMRRFPFHFEFRKSN-N-QIFPIELNPLRFGQ 281 Rivularia sp. P...
CCZ51399     201 ILNIFQHPFLNSKD-VSDRI-YLMSVGIMTKYMAKF-GLLLREIGQLKNIKNFPVHIELRVTKDG-KIIPIEVNPMRFAG 276 Acinetobacter s...
WP_012765876 200 IINILGHLFASSDD-VSDRC-YITSTEIINKHHDEF-LNLLQEIGKRARLKNFPIHIELRTDGRG-NLGVIEVNPMRFAG 275 Desulfovibrio s...
WP_015902940 200 ILNILEHVFSSDSD-VSDRV-YMTSKKLIETNLKEF-TEFAAKIGRLAGVKNFPVHIELRRDCSG-ILLPIEVNPMRFGG 275 Desulfobacteriu...
ACA41642     152 ILNIFKRMFRHEKD-MSDRI-YYTSKQVINESLNNI-QQFLKTISSLFALKLVPIHIEIRIDNLG-QIVPIEVNPLRFAG 227 Lysinibacillus ...
Q8TPB8       276 WCTT-D 280 Methanosarcina acetivorans
WP_012875107 294 KCST-I 298 Thermobaculum terrenum
WP_012871610 297 LCST-V 301 Sphaerobacter thermophilus
WP_014370894 295 QISS-D 299 Paenibacillus mucilaginosus
EKD75377     290 CRIC-D 294 uncultured bacterium
WP_015120438 282 VALP-D 286 Rivularia sp. PCC 7116
CCZ51399     277 WCTT-D 281 Acinetobacter sp. CAG:196
WP_012765876 276 WCVT-D 280 Desulfovibrio salexigens
WP_015902940 276 WCTTpD 281 Desulfobacterium autotrophicum
ACA41642     228 IGTN-E 232 Lysinibacillus sphaericus C3-41
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap