Conserved Protein Domain Family
ATP-grasp_4

?
pfam13535: ATP-grasp_4 
ATP-grasp domain
This family includes a diverse set of enzymes that possess ATP-dependent carboxylate-amine ligase activity.
Statistics
?
Aligned: 18 rows
Threshold Bit Score: 153.978
Threshold Setting Gi: 212560347
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
goetting:HRM2_10390  121 LPLPFIIKPIVGFFSMGVYKVSNIHEWGNAIEAIRTEIDQVKNLYPQEVMDPSAFIIEQCIDGDEFAVDAYFNSLGEPVI 200 Desulfo...
sklvwiv:Bsph_4181     73 LPFPIIVKPVIGYSSVGVHRIDKVEEYKETIEQLKFEMEVTSAEYPIEVINNQSFIIEKLIEGDEYAVDVYFTEEGEPVI 152 Lysinib...
Q8TPB8               121 IKKPFIIKPAVGFFSLGVYKVSTDEDWAPVIKRIKAEVEEIKGRYPVQVLDVGNFIIEENIEGEEFAVDAYFNSAGKPVV 200 Methano...
jgi:Desal_0283       121 LPIPCVIKPSVGFFSLGVHMVESIEGWHQAVDEIKNEVEQIKTMYPAKVLELDNFIIEQCIEGEEFAVDAYFDKEGNPVI 200 Desulfo...
jgi:Riv7116_4455     128 EVENVVLKPSLGTASIGIRTIKGQQEWGKAVDSVLKDIDVAKEHMNPAMLNDASFLVEEFVDGDEFACDGFWDSNGKTVI 207 Rivular...
MA:Aflv_1026         147 ISFPCVIKPVDDSGSNGVTICQNRRDLEL---SLREEWQRQRN--ERGYVLERKWLIEEWIEGQEFSAEMLYTTDGWKLI 221 Anoxyba...
EKD75377             143 IGFPCIIKPVDQSGSMHVSKINNLAELSAAYHAMCND--PWTEMGK-G--IGSVALIEEYINGEEFSVEGYVDNQ-YTQI 216 uncultu...
zhongguo:PM3016_4333 147 IGYPVVLKPTNCASSQGVYFINREEELREAFAQLQ----QFKVTYMDFKV-REEYLVEEYIGGPEFSVELFL-QEGTPVF 220 Paeniba...
jgi:Sthe_1127        148 VNYPCVVKPTILSGSRGVIRADDPDQFVAAFARTRDI--LASEGWAP---EAASILVEEFLPGFEVALEGLLTENGLQVL 222 Sphaero...
CCZ51399             122 IRFPVVLKPSVGFLSFGVHTIKESKEWKDVISQLEKEMRMAAMMYPNHVVNSTKFLIEEMIEGEEYAVDAYFDRDGEPVI 201 Acineto...
goetting:HRM2_10390  201 LNILEHVFSSDSDVSDRV-YMTSKKLIETNLKEF-TEFAAKIGRLAGVKNFPVHIELRRDCSG-ILLPIEVNPMRFGGWC 277 Desulfo...
sklvwiv:Bsph_4181    153 LNIFKRMFRHEKDMSDRI-YYTSKQVINESLNNI-QQFLKTISSLFALKLVPIHIEIRIDNLG-QIVPIEVNPLRFAGIG 229 Lysinib...
Q8TPB8               201 LDILKHIFSSENDVSDRV-YFTSKAVMETYRETV-EDLLKEIGKLAGLKNFPLHIEIRIGEDR-RIQPIELNPMRFAGWC 277 Methano...
jgi:Desal_0283       201 INILGHLFASSDDVSDRC-YITSTEIINKHHDEF-LNLLQEIGKRARLKNFPIHIELRTDGRG-NLGVIEVNPMRFAGWC 277 Desulfo...
jgi:Riv7116_4455     208 TGIYQHPFASSLDVSDTV-YYTSTKVLAQTIEPT-MQVLEHIGAKLGMRRFPFHFEFRKSN-N-QIFPIELNPLRFGQVA 283 Rivular...
MA:Aflv_1026         222 SVT-KKETYGSHAV-ECG-HVTSPKL--NPFYDL-EERCKRLLNLLGLNYGAAHIEFFVRGN--NLYLVEVNP-RLAGDC 292 Anoxyba...
EKD75377             217 ASIT-KKFLTPEPLFIEMgHIVPADITLEKQKII-KQYVKEVIAALNINLGVFHAELRIDEEG-PVLM-EI-AGRLAGCR 291 uncultu...
zhongguo:PM3016_4333 221 AAVTEKRTSPLPYFVEVL-HTLPTSVHRESEAALiDTAVSALK-AIGLVNGPSHVEVKLSADGpRIIEV--NGRPGGDQI 296 Paeniba...
jgi:Sthe_1127        223 ALFDKPDPLDGPFFEETI-YVTPSRLPEETQAAI-AETTARGAAALGLRQGPIHAELRINERG-PWI-IEMAGRSIGGLC 298 Sphaero...
CCZ51399             202 LNIFQHPFLNSKDVSDRI-YLMSVGIMTKYMAKF-GLLLREIGQLKNIKNFPVHIELRVTKDG-KIIPIEVNPMRFAGWC 278 Acineto...
goetting:HRM2_10390  278 TTpD 281 Desulfobacterium autotrophicum HRM2
sklvwiv:Bsph_4181    230 TN-E 232 Lysinibacillus sphaericus C3-41
Q8TPB8               278 TT-D 280 Methanosarcina acetivorans
jgi:Desal_0283       278 VT-D 280 Desulfovibrio salexigens DSM 2638
jgi:Riv7116_4455     284 LP-D 286 Rivularia sp. PCC 7116
MA:Aflv_1026         293 IP-E 295 Anoxybacillus flavithermus WK1
EKD75377             292 IC-D 294 uncultured bacterium
zhongguo:PM3016_4333 297 SS-D 299 Paenibacillus mucilaginosus 3016
jgi:Sthe_1127        299 ST-V 301 Sphaerobacter thermophilus DSM 20745
CCZ51399             279 TT-D 281 Acinetobacter sp. CAG:196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap