Conserved Protein Domain Family
AAA_24

?
pfam13479: AAA_24 
AAA domain
This AAA domain is found in a wide variety of presumed phage proteins.
Statistics
?
PSSM-Id: 316040
View PSSM: pfam13479
Aligned: 62 rows
Threshold Bit Score: 108.889
Threshold Setting Gi: 81397874
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9A0Q7        10 RAQRVIIYGPEGIGKSSFAAN-------F---------P--E---------PLFIDTEGSTDNMDVAR------------ 50  Streptococcus p...
AEJ39651      15 AKARIGLIGPAGSGKTYTALR-------Masa----mgQ--K---------IAVIDTEHGSASKYADE------------ 60  Sulfobacillus a...
WP_015709161  11 lyLRCALFGPSGSGKTMTALR-------M---------A--KgiadtmgvpFAVIDTEARSASKYADR------------ 60  Treponema primitia
WP_013379580   1 MSRMILVMGESGSGKTTSMRN-------Ld-------pK--S---------TFYIDCDKKGLSWKGWR------------ 43  Eubacterium lim...
WP_008728300   1 MSKVICVMGESGSGKTTAMRN-------L---------PpeE---------TVYIDCDKKGLSWKGWR------------ 43  Erysipelotricha...
CCZ53896      13 vKLRLAIAGPSGAGKTYSALLiasgivpL---------E--K---------VAVIDTESGSADLYADL------------ 60  Dialister invis...
CDC47057       1 MSKVICVAGESGSGKTTSMRN-------Ld-------pK--T---------TLYIDCDKKGLSWKGWRsqynsenqnyik 55  Firmicutes bact...
CDD80306      14 lSYNIGLIGESGIGKTTIVKE-------MceklvgedgY--R---------FLECGKEDGADGINGIN------------ 63  Ruminococcus sp...
WP_014424987   1 MANSILIIGESGAGKTTSIRT-------Ld-------pK--T---------TFIIDCDRKGLSFRGWK------------ 43  Selenomonas rum...
CDC41112      14 LAYNLMLIGESGIGKTTVIKE-------Ycdrl-apdkY--I---------FLECGKEDGADAIDGIN------------ 62  Clostridium sp....
Q9A0Q7        51 M----------DKPT-------------S----------Y-------------TM--------------L-----K---- 61  Streptococcus p...
AEJ39651      61 F----------TFDV-------------Atl------pdF-------------DP--------------R-----T---- 75  Sulfobacillus a...
WP_015709161  61 I----------PFDV-------------D----------D-------------LD--------------G-----Ktvdh 75  Treponema primitia
WP_013379580  44 K----------QYIP-------------T----------E-------------KDkqngnywassnasaI-----T---- 68  Eubacterium lim...
WP_008728300  44 NeynadnknymVSDD-------------A----------D-------------KI--------------M-----R---- 64  Erysipelotricha...
CCZ53896      61 G----------GYST-------------V----------T-------------IN--------------PpyspqK---- 76  Dialister invis...
CDC47057      56 T----------DFAQ-------------V----------V-------------QQ--------------T-----L---- 66  Firmicutes bact...
CDD80306      64 Y----------LNCP-------------E----------WsmdydeetnsigfED--------------F-----V---- 87  Ruminococcus sp...
WP_014424987  44 K----------MYNT-------------AnknyiatsnlE-------------TI--------------W-----G---- 64  Selenomonas rum...
CDC41112      63 Y----------INCPewdmdydkntnsvG----------F-------------AT--------------F-----I---- 86  Clostridium sp....
Q9A0Q7        62 NQIAWI-K-ANPTCCKTLVIDTIDWAESLIVDDVCAQHGK-KG----I---EDFGWgn-gYTYTKEEVGRF-LNM-LQEL 128 Streptococcus p...
AEJ39651      76 YMAAIQ-A-AAESGYEVLVIDSASHEWYACLEMVDRQAPRf-----------GGNAwa-aWSQVTPLHRKF-VDT-LLDA 139 Sulfobacillus a...
WP_015709161  76 YIAAMN-E-CVKAGYKVLVIDSLSHAWRELTDEVDR---IaQS----S---VSKNTfs-pWAKVNPKQKRF-IDA-ILNF 140 Treponema primitia
WP_013379580  69 QIMVKI-S-AEKPQIKTIVIDTLNWV--MIDDEFKRMKEKgYD----K------------WQDLAFSVKEM-VAM-GQQL 126 Eubacterium lim...
WP_008728300  65 -MLVKI-S-DKRPEIKYVVIDTINGI--MVGDEMRRCKEKgYD----K------------WMDLAQCIWNM-VDT-APTL 121 Erysipelotricha...
CCZ53896      77 YIEAIH-A-AEAAGFELIIIDSLSHTWSGEGGLLDQQGKAaDS----K---YRGNSwa-aWREITPLHNQL-VET-MLHT 144 Dialister invis...
CDC47057      67 QKVDKV-E-KWKH-IKVVVIDTINGL--MVSDEMRRSKEKgYD----K------------WVDLAACVWDL-VNE-AYEY 123 Firmicutes bact...
CDD80306      88 DDVVEN-KsTEYPDLKTVVIDTYDQLVEIAKPEVIRMHNAeNPekpvK---SIKAAfg-gYMAGEDKATEIvLNK-LWEL 161 Ruminococcus sp...
WP_014424987  65 YLKRIS-Y-QDMTHIKTVIIDTLNGI--MVDDEFRRMHEKsFD----K------------WQDLAASVYGL-VTD-IHEL 122 Selenomonas rum...
CDC41112      87 DDVVENrT-TEWSDLKVVVVDTYDELFAIAEPEVIRMHNRqNP----DkrvDSIKAafggFQGGEDKTLEI-VLDkLWEL 160 Clostridium sp....
Q9A0Q7       129 ---IElgiNIVLTAHAQMRKFEQPDEMg----A-YDRWELKLGKK--TssqtAPLVKEWADMVLFANYKTV--------- 189 Streptococcus p...
AEJ39651     140 ---PL---HVIATFRAKTEYAQVTGAN-----G-KTEI-QKVGVGavT----RDGMEYELDIIGELDLshvltitktryr 202 Sulfobacillus a...
WP_015709161 141 ---PG---HIIATMRSKTEWVIGEGKGgkvapE-KMGLAPEQGKG----------IEYEFDLLMELDQK----------- 192 Treponema primitia
WP_013379580 127 ---REd-lTVIFTAHTQTERDDS--GF-----A-FTRMKTSGKKL--D----KISIESMFTTVLLAK------------- 175 Eubacterium lim...
WP_008728300 122 ---RDd-lNIIFTAHTQTERDDS--GY-----M-FTRIKTSGKKI--D----KICLESKFTTILNAK------------- 170 Erysipelotricha...
CCZ53896     145 ---PL---HVIVTMRSKTEYIQTEVNGrk-qiQ-KVGMAPIQRDG----------IEYEFTTVFDLS------------- 193 Dialister invis...
CDC47057     124 ---RDd-lTIIFTAHTQTDHDE--NGY-----M-FTRIKTSGKKL--D----KIALESKFTTVL-----LS--------- 171 Firmicutes bact...
CDD80306     162 ksvGV---HFIIIGHVKQRTQDDVTTG-----QtYTSLTTNMSMR--D----FNAIKTKLHFLGVASIDREivqektgkt 227 Ruminococcus sp...
WP_014424987 123 ---RDd-lTIVCTAHAQTDRDD--NGY-----M-FTHMKTSGRKL--D----KIVVESKFTTVLLAKAD----------- 173 Selenomonas rum...
CDC41112     161 ---KHmgiCFILIGHTKTRNMTDPVTGq----E-YLQLTTNLPQK--Y----FNGIKTKVHILGVASIDRE--------- 217 Clostridium sp....
Q9A0Q7       190 ---------------Vmtses------------kkkkaTGGQRVLYTQHHPAWDAKNRH 221 Streptococcus pyogenes serotype M1
AEJ39651     203 diankqfeqpgedlaklilqwlqagaptetverltteqgkqlwafaqqhqldvpalltl 261 Sulfobacillus acidophilus TPY
WP_015709161 193 -------------------------------------------------HQATVTKDRT 202 Treponema primitia
WP_013379580 176 --------------------------------------CVDGKYLFETQSNSSTAKSPM 196 Eubacterium limosum
WP_008728300 171 --------------------------------------AAGGRYVFETHAKNSTAKTPM 191 Erysipelotrichaceae bacterium 2_2_44A
CCZ53896     194 -----------------------------------------------QNHTATVSKDRT 205 Dialister invisus CAG:218
CDC47057     172 ---------------K----------------------CVDGKYKFETQANNSTAKTPM 193 Firmicutes bacterium CAG:424
CDD80306     228 kkegkkdvdimkgviT----------------------SESRKITFRDDSYSIDSKSRF 264 Ruminococcus sp. CAG:9
WP_014424987 174 ----------------------------------------NGKYVFETHANHSTAKSPM 192 Selenomonas ruminantium
CDC41112     218 ---------------IvkektgkkdfvtkkdiekgvvtNQTRKITFRDDNYVIDSKSRF 261 Clostridium sp. CAG:352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap