3JCR


Conserved Protein Domain Family
TPR_14

?
pfam13428: TPR_14 
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 404331
View PSSM: pfam13428
Aligned: 425 rows
Threshold Bit Score: 26.9645
Threshold Setting Gi: 123098034
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JCR_G             405 RLWKAAVELEEPEDARIMLSRAVECCPTSVELW-LALARL 443 
jgi:MICPUN_54824   202 VLASLRVLQGRSDEALEALRQSMAIWRSVRKST-TAGNDD 240  Micromonas commoda
Q9BKR2             505 ALSTIYLEMNNISDAIDELQQMVRLHKENKSVW-ARLADA 543  Caenorhabditis elegans
WP_010847439       348 VMTDIDIEQKQYANAISRLQNALKKYKDNPVLQ-INLANA 386  Xenorhabdus nematophila
jgi:Mrad2831_4991  176 VLAPVYMRTGRFDDAARAYANIARIKGETADLL-ADQGEA 214  Methylobacterium radiotolerans JCM 2831
Q2YMU8             160 VLAPIYLRLGRASDAVSAYRTSIRIAGENLARI-LGLGea 198  Brucella abortus 2308
WP_015758565       387 FLANEYMMAGRFEDAMEAIDKAFKLKNSDKGYLyKMKYNL 426  Desulfofarcimen acetoxidans
jgi:Oter_0459      714 YLAQAMHGNGQSSEAIQALQTSLQLDVTNGEAW-LMLIDL 752  Opitutus terrae PB90-1
XP_002456764        22 TSIHRHIEAGAFEQAAKVADQVLKAAPGDEDAV-RCKVVA 60   sorghum
WP_080825508       159 VLAPIYFKTLRLGDAELAYRNALRILGPSPERL-TGLGET 197  Agrobacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap