Conserved Protein Domain Family
O-antigen_lig

?
pfam13425: O-antigen_lig 
O-antigen ligase like membrane protein
Statistics
?
PSSM-Id: 315988
View PSSM: pfam13425
Aligned: 20 rows
Threshold Bit Score: 243.752
Threshold Setting Gi: 524375997
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q74HR3     2 KKRLQTFLFWFILIQPFLDIywlsrppL----------L-KFSIPTILRVLGVFIAIILFFSIKNNWQRFRKqwwiIA-Y 69   Lactobacillus john...
Q1G8D3     2 KEKTKSLLYWFILLQPFLDLdffyrgkLat-------iL-PFTIPTIIRIAGVIVLVGLLVWGQKQLPPAWL----WA-Y 68   Lactobacillus delb...
CDE39333   6 NKKIANIFYVFLLIQPILDL-------Ltslmt-rfagL-PLTIGMIVRGLFLFGMIIYLVFINKSVHKKKS----LI-Y 71   Firmicutes bacteri...
CDE82293   8 IYSSKVVQAIFIIL-PFVEF-------Itsymv-lnvdF-PITLGVIYKTLFLIYGLGYLIFVDKENRKWNF----IL-- 71   Clostridium sp. CA...
CDB19979   3 KEKKIILLNWYIILQPIIDI-------Ltslgv-rygsD-SITLGVAIRAVFVGIMAFYVMFIYRGKYEKTV----KI-Y 68   Blautia sp. CAG:52
CCY46286   7 eRFLKKILLIFLCIQPILDC-------Yilytd-evinFfHFSPTTILRMLIIAFLFCSLFFNKENKKNRKI----IY-I 73   Firmicutes bacteri...
CDA51898   1 MMKHSRKLETYFLLLPFLDM-------Itallt-rntsL-SVTPGIIIKSIFLLFMVLYI-FKTKSKYKKAS----LG-L 65   Clostridium sp. CA...
CDA17154   7 NVNIKRICIVFILIQPILDI-------Vtsilv-rhinS-IFTIGIFIRSIFMIFVVMYGILISAPKERKKI----LI-Y 72   Clostridium sp. CA...
CDB28745   3 KFYNNRILTKFMLIQPLIDI-------Itslmi-neynF-HISLGMICRFIFLIYAGIYIIKNRDSKINTYI----II-W 68   Firmicutes bacteri...
CDA23472   8 NNILLKILTIFVLLQPFLDT-------YilfdasftgeI-GFSPSTLIRYLFIMVLAILFVFTIKSKKKYVY----YLvY 75   Mycoplasma sp. CAG...
Q74HR3    70 IGVLILY-SICHLISVKNFTGVDATGFHYSAKVEIFYLVRACLPLIVIYI-TSYSEFQAKYFFRVIQGISGIYSLTIVIS 147  Lactobacillus john...
Q1G8D3    69 LDLLTLY-GIFHLWHMQNFKSLSPNDYGYSNFGEIFYLFRMLLPLALIWV-TKKLEISQDFLLKAFAWVSGLFTGTIVLS 146  Lactobacillus delb...
CDE39333  72 LAILCIF-SILYIITKNGILSLGFLKTEVIYLFKYMYFPITALCLINVFD---EIKLEKEKIFKICIIEALLYSILIIMP 147  Firmicutes bacteri...
CDE82293  72 LGLFAVT-IIANIVFTLSSFSMSALMNKAVSMTKYMCLPVTLFFLYRYLKnGNEFSLKT------LVYSAGIYATAILIS 144  Clostridium sp. CA...
CDB19979  69 VAIISVY-GLAFLANAAVCSGTYTIITNIKMFIKMYYFLYVLLGLFCMYQqYQYVVSDW-----LLVGVYCEYTVSIFLS 142  Blautia sp. CAG:52
CCY46286  74 YGGLIIIyTILHHLITSGVDNSGYPTFSYSIITELFYIIRMLLPIVIIYL-TYLLKPTKDEFIKLFLIVGLITSGIIVCS 152  Firmicutes bacteri...
CDA51898  66 LLLIFIY-MIGYFLFKPDLLNWTYIIKELTFIFKLIYFPISFMGLLCIYD---DNNYSKESIINIIKKTLIIYVFLLLIP 141  Clostridium sp. CA...
CDA17154  73 YGVLALY-LVIFIATMCITNGKNMIFTQIKGAIKCFYLPIILVALFTIFT-KKNIKINS----NIYIYTLLIYCFSIFIT 146  Clostridium sp. CA...
CDB28745  69 IIYLLTS-FVGHFL----LDSHFNIMSFGVNMAKLIYFPIILLFFTLYFKkNEELDRFT------FIIIALIIGISLLTS 137  Firmicutes bacteri...
CDA23472  76 GLMVIVY-VILHHYYCLNMTTLFPNNFNYSLMQEIEYIIRLTVPLVLI-IiASNLNINKRLFNNVCIWISLIISSIIVIT 153  Mycoplasma sp. CAG...
Q74HR3   148 NLFLFSLT---SYhtteakrisanifswftqtnY-------------------PFNALASKGVFFQANTLSAILFMIMPI 205  Lactobacillus john...
Q1G8D3   147 NLFVVSLK---SYetgvisgni---ftwfmgplY-------------------GYSHSASKGFFYFTNTLSAILLMLAPV 201  Lactobacillus delb...
CDE39333 148 EITNTAFS---SY----------------------------------------LDDNKGTVGWFYAANEIGAIMVALFPF 184  Firmicutes bacteri...
CDE82293 145 AITGTALP---TY--------------------D-------------------TAPERGISGWIYSGNELSAMMSLFYPI 182  Clostridium sp. CA...
CDB19979 143 AITNTSFG---TY-----------------------------------------DYGKGYCGWFYAGNEVGAIISILAIV 178  Blautia sp. CAG:52
CCY46286 153 NILEISLA---SYgggtikgni---fdwffsnkY-------------------GSQDLASKGWFNSANQISGLMFILLPI 207  Firmicutes bacteri...
CDA51898 142 LIFNAAYT---TY----------------------------------------PKSLKGYIGLFYAGNEVANIMVMLFPI 178  Clostridium sp. CA...
CDA17154 147 KILGIAYP---TY--------------------S-------------------IGLNVGTTGLFFAANEIGIILGILAVI 184  Clostridium sp. CA...
CDB28745 138 VITKTAYCsysSY--------------------E-------------------NCYHKGIVSWFNSANEYGLILIALLGY 178  Firmicutes bacteri...
CDA23472 154 NIFKISIG---AY--------------------YtqtvqynifdwfngihnsvSFMYTATRGYFNYANLISSLLFGLTIY 210  Mycoplasma sp. CAG...
Q74HR3   206 ML-YIL-----YKEF-NVLNIVLVSSQALAMLMLGTKVGNFGLIISLVVFVLVFLIHsLILKNTRFSAKFL--------- 269  Lactobacillus john...
Q1G8D3   202 VF-YLL-----LERF-SWKTGLLALSQTLAMLEVGTKVALYGLAGTLAVSLIAWLVHlFCLKNVKFSKGGL--------- 265  Lactobacillus delb...
CDE39333 185 LY-YLL-----FEREgIIKIALIFTIVILAMTLLGTKTSFLGMLITEIIYALYFIFN-YKKNRAYGLKWSIii------i 251  Firmicutes bacteri...
CDE82293 183 VIyYA------AKYK-SLSFMFILAVMTYGLLVIGTKTALIGLIGAILGILIFSIIA-YAWKRKKIAKSTL--------- 245  Clostridium sp. CA...
CDB19979 179 ALfWAV-----KSKK-KFVWISIGFLCAFSGTYVGTKVPLLASAMAVIVLGFVCLIQ-KILYKT----SSRni------i 241  Blautia sp. CAG:52
CCY46286 208 CV-YSL-----FDKI-TKPRVITIILLVISMIMLGTRVASYGWLLIFIMMIILYLFFaLIMKNIKFEWKKFl-------i 273  Firmicutes bacteri...
CDA51898 179 AYlYLN-----NKKF-NF---LILFPIILSILLIGTKVATFGCLIITLITLVFSVIK---------NKFKMty------t 234  Clostridium sp. CA...
CDA17154 185 LFrELFmkkveNKRN-FILYIVTLFLYIYSILEMGTKVPILAFLGILCVTIIMCIVN-AIKINKKIFMKKIlg------i 256  Clostridium sp. CA...
CDB28745 179 SLiDYI-----KS-K-NIYNIVSSLITIIFLCILGTKASYVGCVGLLGCAFIFYFAYnKLIIKHKLNLKSLfflggills 251  Firmicutes bacteri...
CDA23472 211 -IlYLV-----ISEC-NFKNSICLILNFFAMFMLGTKVATLGMLICLIIMILCYFFF-IIIKKERFVLKPF--------- 273  Mycoplasma sp. CAG...
Q74HR3   270 ITLICILTASA--AIFP---YS-PTLRRSSLESGVAQKrsnlgD---------------KKRLDQElnaglerykg---- 324  Lactobacillus john...
Q1G8D3   266 VTLLALAGITG--VCWQ---VS-PAVQRYKYEIYLANS-----H---------------DSKIDQEnallkaglakyknd 319  Lactobacillus delb...
CDE39333 252 VISFGLIPNIP--AVKN---LQ-NAISESS-------------------------------------------------- 275  Firmicutes bacteri...
CDE82293 246 IITLILTVAVA--IAMP---YS-PSYKYIEGKINKIINqsknpD---------------GEENNQ--------------- 289  Clostridium sp. CA...
CDB19979 242 RCVIILLAYCT--LYMA---NS-PVRQNNGIMVTEHYEe----------------------------------------- 274  Blautia sp. CAG:52
CCY46286 274 IFLIMIFGIFL--MLNApivSS-NIDHHESTEEELQKMrdenvP------------------------------------ 314  Firmicutes bacteri...
CDA51898 235 VIKCLAVFIFT--LVLS---L--NSYAVYNYNYTKNNYykdeqK---------------EIVIDES-------------- 278  Clostridium sp. CA...
CDA17154 257 LGILIFIVLIL--PYTA---VGiNINRNYGINTDLLSRikingK---------------EIENKSN-------------- 302  Clostridium sp. CA...
CDB28745 252 IFVFTIKLPIYtnLIGS---YE-RAYENSGGNYCETCCpkfdkT---------------SEEIRNE-------------- 298  Firmicutes bacteri...
CDA23472 274 IIIVVLIGLWF--VIYP---YS-PCYNRLNGNNNDNNKnneviEdgkfnkflltlnslsEYDKINYsk------------ 335  Mycoplasma sp. CAG...
Q74HR3   325 -kkqedylkefIKKNYWVYSL-KhD-LVLEHYTYQNDPYYWLEVMKRPA-NERLNYRHLEKDILNRVMKtD-KN---KSN 396  Lactobacillus john...
Q1G8D3   320 pdklkefekyfLAKYYQKYAL-NkR-FITKSYPYKYDPQFWIDLLKEPA-SVRLANRKVEEAMLKQVVKyD-ND---PLD 392  Lactobacillus delb...
CDE39333 276 -------------------HI-K-E-EVKEDNEKENNKYASSSPSVQRIiKVALSGRDKFFYNTLEIYD-N-AN---IDD 328  Firmicutes bacteri...
CDE82293 290 ----------------------------------------------SSVeNLIFNGREKYVYEQKQLAG-N-AS---PLE 318  Clostridium sp. CA...
CDB19979 275 --------------------------sVVEKEEALENEENIQKNKAYLViNWLLSNRLVYVEGTINRYC-T-GT---VSE 323  Blautia sp. CAG:52
CCY46286 315 -----------TIKMLGYIGM-N-EeYYKEIYPYKDHKDFWQYVLDDVApTRRVGNRNSQQLVTNDVAKtY-ED---FPR 377  Firmicutes bacteri...
CDA51898 279 ------------------------N-VVEVETIKNNILRFYDTNKLSKIvKPLISGRDMLLANTLSVYD-DiND---DSN 329  Clostridium sp. CA...
CDA17154 303 -----------TEK---------------------------IFNNKEEVtTAALSGRNLFLRNNMNEFT-E-GK---GAN 339  Clostridium sp. CA...
CDB28745 299 -----------I------------------------------------SsSLVFNGRDDFLIANKAMYK-N-ST---LFS 326  Firmicutes bacteri...
CDA23472 336 ---------tfIKENYKYFGIrK-D-YMFKKYSYEYDPLFWIEMYNEDTfNKK-DNRFIAEKVLQRIEQ-N-NTnnkTGV 401  Mycoplasma sp. CAG...
Q74HR3   397 KLFGISFSREN----N----I---AP------LERDFLAQYYSMGILGVILLDVIYLFVLGYGIFYwLFNKKVRSFLNSS 459  Lactobacillus john...
Q1G8D3   393 KWLGIGYMRQT----N----I---SN------LERDFTAQYYSLGLVGAFLYLAFYPAIILYGAFEwLKEKACRTLYLTS 455  Lactobacillus delb...
CDE39333 329 KLLGIGFVNRN----E----I---NNkrieklIEIDPLDVFFHYGIIGFIIYFSPLIYIVYRTLKS-IFKNKFR-LSFFK 395  Firmicutes bacteri...
CDE82293 319 LLIGLKDEHRV----I----D---DTgny-tvVERDFHDVKFGYGIIGLGIYLVPIFIIAISFFIR-LFKNFKEEFTVRN 385  Clostridium sp. CA...
CDB19979 324 KLLGLGYSYTV----G----KglnSNl-----IEMDFLALLFYHGIVGLMIYILPICFFAVYCIRA-LWKAIKKIFENES 389  Blautia sp. CAG:52
CCY46286 378 SLFGLGYSRFI----N----A---KLy-----LEKDFVVHFYTIGIIGIVLLIFPYVFIAIYGLFKsIKNKKFNLFIVT- 440  Firmicutes bacteri...
CDA51898 330 IWFGIGFSNTE----K----V---NNtniarlIEIDICDLYFHFGIMGLIISLYPIIFIGYLLII------NYKKLTLNC 392  Clostridium sp. CA...
CDA17154 340 KLFGIGYVDINskgtV----E---RKt-----VEIDYCDILFMQGIAGFILFWLPIAYIIFYIIKYtIKNIKYNILDVEI 407  Clostridium sp. CA...
CDB28745 327 KLYGLTYDDRI----YqgihY---EKn-----VERDFHDLLFQYGIIGFIIELSLPLYLLLSILIK-IIKTKKNRIDEEI 393  Firmicutes bacteri...
CDA23472 402 KLFGEGYSRMT----N--------TIy-----LEKDFLSQYYTIGIIGILLFILPYILIPFVSLFYiLFNRKYFTFENIS 464  Mycoplasma sp. CAG...
Q74HR3   460 LLL---SEGFILFAAFYAGNVLEYLSATLVMAFILGFLLQNIRYS 501  Lactobacillus johnsonii
Q1G8D3   456 LLI---ASALLLGASYMSGNVLDFPTSNLLLAFLGGGLLAYIKEE 497  Lactobacillus delbrueckii subsp. bulgaricus ATCC 1184...
CDE39333 396 LTNi-yVIGIITMISMMAGHVYSAPAVSIYVSFAMAMLDSALTKg 439  Firmicutes bacterium CAG:321
CDE82293 386 FCVg-lSGLLGIGIAYIVGHVLLAPTVAMFLGAVFIKFNDRQNKE 429  Clostridium sp. CAG:273
CDB19979 390 AIVytyGILIGLACAAVSGHVLIAPAVSIYIAILIIKLVDNSDNN 434  Blautia sp. CAG:52
CCY46286 441 --Vl-aILVLPLGVSYFSGHIVDELIISLYLGFIGGYILCECKEA 482  Firmicutes bacterium CAG:822
CDA51898 393 YYLi-tILLLLAGISTLSGHVLFAPAVSiylvlyllliteelnlt 436  Clostridium sp. CAG:533
CDA17154 408 ISKy-iIIGLAFCVAMFAGHTLVAPAVSIYIALAVVKLYMDLKEN 451  Clostridium sp. CAG:571
CDB28745 394 CILa-tSTAFVLLGSYLAGHFLFAPAVSIYVAYSIALLSKKVGNI 437  Firmicutes bacterium CAG:582
CDA23472 465 III---CIFASLAGAYFCGNTLDGLTWSIIYSFIFGYLISKLFKk 506  Mycoplasma sp. CAG:611
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap