Conserved Protein Domain Family
HAD_2

?
pfam13419: HAD_2 
Haloacid dehalogenase-like hydrolase
Statistics
?
Aligned: 51 rows
Threshold Bit Score: 126.543
Threshold Setting Gi: 187720742
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:GWCH70_1783          5 VIFDLDGTLLNRDVSIQKFIEYQYERLqlWLShIPKESYIARFIELDNRGYVWKDAVYQQMVKefeiigiTWEDLLEDYM 84  Geoba...
jgi:Rumal_1805           7 YIFDFDLTLADSSKGILECFRHTLKYF--GYE-VPDDSTIYNTIGLTLQDAFDILTGIPMNPQre----kMRKVYVEKAN 79  Rumin...
BAK15155                 6 LLFDFDGTLLNTNDLIIQTFMYIFDEK--FPG-QYSTEDCLRFIGPSLKQTFDELTP-GETDV-------MIGKY-KEWN 73  Solib...
sklvwiv:Bsph_0436        6 LLFDFDGTLLNTNELIIQTFMHVLNER--FPG-QFSPKDCLKFIGPSLKQTFNDIAP-GEEEA-------LIAKY-RAWN 73  Lysin...
PRJNA223427:T479_19400   6 LLFDFDGTLLNTNDLIIQSFMHVLEER--FPG-QYSPKDCLKFMGPSLKQTFSVLTP-GEEDE-------MIAKY-RAWN 73  Lysin...
ADO54148                 5 ILFDLDGTIMDTNELIISTFLHILNHP--DAD-PLTREHIIPHMGGTLDDQLRTFTGLTDVSG-------LIKDY-RAYN 73  Paeni...
IGS:BMD_5061             6 VLFDLDGTLIDTNELIIASFTHTLNHY--YPE-QYTREDILQFMGPPLYDTFVEMDK-TKVNE-------MIEMY-RTHN 73  Bacil...
ADC49142                14 LLFDLDGTLINTNDLIIASFLHTLEQF--KPG-EYTREQVINFIGPPLIDSFRKVDP-ERYEE-------MIDVY-RTHN 81  Bacil...
jgi:Bcell_3571          12 ILFDLDGTLINTIELIVASFLHTMEHY--YPG-KYTREDVITFIGPPLSETFTNLDP-SKVEE-------MTKTY-RTYN 79  Bacil...
Q9K6Y7                   6 VLFDLDGTLINTNELIISSFLHTFETY--YPG-KYGRKDAIECIGPPLTDSFKRLDP-ERVEE-------MVATY-RKHN 73  Bacil...
jgi:GWCH70_1783         85 NHFHK-SCAPFPHLVWMLEELKRKSLKLGIITNG-KGQFQMHSIKVLGIEGYFDTILISEWEGISKPDPRLFQKAMDHLN 162 Geoba...
jgi:Rumal_1805          80 EVMSA-HTYFYEDTLSILEKLREHDIKIAIVSSKmRYRIVESFEVQLGV-HPYDVIVGMEDVTEPKPDPQGIIKAMELLG 157 Rumin...
BAK15155                74 AINHDrLVTSYDAVVETLEELHKLGVKMAIVSTK-SRESLARGLKVLCAEQFFDVIVGLDDVEHVKPHPEPVLLALQKLG 152 Solib...
sklvwiv:Bsph_0436       74 IEHHDeLVSQYPDVVSTLEQLKAQGIRLAIVSTK-RNDTIDRGLSILGATHLFDVRIGTDDVHNVKPDPEPVLLALERLG 152 Lysin...
PRJNA223427:T479_19400  74 EPHHDeLVTEFPDVVSTLEQLKSMGIKLAIVSTK-RNAMIDRGLRILGASHLFEVIVGTDDVQHVKPDPEPVLLALTRLG 152 Lysin...
ADO54148                74 QIHHDqMVKPFPHVIEVIQELRARGIKLGVVTTK-IRPSTMRVLNLFDLTSSMDYIVTVDDVEHPKPHAEPVLKALAGLN 152 Paeni...
IGS:BMD_5061            74 LANHDlLVKEFEGVLETVKWLHEQNYKLGIVTTK-QRNTVMMGLKLTKLEQFFDTIVAIEDVTNAKPHPEPVEKALKLLN 152 Bacil...
ADC49142                82 HSFHDeLVKEYEGVYETIKELHEKGYNLAIVTTK-IRKTALMGLKLMKLDQFFDVVIGLDDVENAKPHTEPLEKALNALG 160 Bacil...
jgi:Bcell_3571          80 HAKHDeLVKEYEGVYETLEKLEEKGYKMAIVTTK-SRGTAVRGLELMKLDKFFDVVVSLDEVENYKPHPEPLEKAMAALQ 158 Bacil...
Q9K6Y7                  74 HAHHDkLVEPYEGVYETVKTLHEQGFKLAIVTTK-IRETAMKGLKLFGLDEFFDVIVALDDVENVKPNPEPLEKAMNALG 152 Bacil...
jgi:GWCH70_1783        163 VLPNESVFVGDHPiNDIQAARNIGMKTIWK 192 Geobacillus sp. WCH70
jgi:Rumal_1805         158 VTKDEVLYIGDSY-IDAESALNAGVDFAAV 186 Ruminococcus albus 7 = DSM 20455
BAK15155               153 IEKEEAIMIGDNS-HDIEGGQNAGVRTAGV 181 Solibacillus silvestris StLB046
sklvwiv:Bsph_0436      153 INKDDAIMIGDNS-HDIEAGHRAGVRAAGV 181 Lysinibacillus sphaericus C3-41
PRJNA223427:T479_19400 153 VAKEDAIMIGDNS-HDIEAGHNAGVRAAGV 181 Lysinibacillus varians
ADO54148               153 AEAEHTLMVGDSS-FDILSAQAAGVKSAGV 181 Paenibacillus polymyxa SC2
IGS:BMD_5061           153 AKPEEALMVGDNH-HDIVSGQRAYTKTAGV 181 Bacillus megaterium DSM 319
ADC49142               161 VTKEGAMMIGDSP-HDIHAGKNMGIPTAAV 189 Bacillus pseudofirmus OF4
jgi:Bcell_3571         159 ADRSKTLMVGDSK-HDILGGKNAGTKTAGV 187 Bacillus cellulosilyticus DSM 2522
Q9K6Y7                 153 AKKEETIMVGDNS-HDILGGKNAGVKTAVV 181 Bacillus halodurans C-125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap