Conserved Protein Domain Family
TPR_11

?
pfam13414: TPR_11 
TPR repeat
Statistics
?
PSSM-Id: 315977
View PSSM: pfam13414
Aligned: 43 rows
Threshold Bit Score: 41.3033
Threshold Setting Gi: 197087405
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P73762        192 GLIEYEQGKIDTALKRWQEVIKIDSEQPEPQLAIAVALYKQG 233 Synechocystis sp. PCC 6803
35_pfamImport   1 GDKYFQKGDYAAAINNYNQALQDKHQDANIYYKLGLVYHQLG 42 
23_pfamImport   1 GDEYFQKGEYAAAINSYNQALQFNNSDADIYYKLGLVNYQLG 42 
4_pfamImport    1 GDEYFEKGEYTNAIVNYGKALKVTSSDINLYYKRGLTHYQIG 42 
25_pfamImport   1 GDIYFEQSNYSSAVNLYRQALAYSPQDPEIHYKLGKAMKQMG 42 
1_pfamImport    1 ADIYTLRGSFPQAIEQYRELIKLRKDNPLIHFKLAKVYV-NS 41 
9_pfamImport    1 GQSFYAENNYTGALLELSEAEKLTPRDPDLLNLLGLTYYRKG 42 
P73762        124 GNAYFQKGQYDQAVEVLLAGLAQRPDTPAALFDLGNAYLKLV 165 Synechocystis sp. PCC 6803
3_pfamImport    1 GNIYVDKEEQEKALTNYLRACDYTESFPDIYFNCGAIYFNLG 42 
19_pfamImport   1 GRVYMERGEYEEARYNLSKAVVLDPANAEYRYWLGHANEKLG 42 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap