Conserved Protein Domain Family
TPR_11

?
pfam13414: TPR_11 
TPR repeat
Statistics
?
PSSM-Id: 315977
View PSSM: pfam13414
Aligned: 43 rows
Threshold Bit Score: 38.6069
Threshold Setting Gi: 428687020
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012530093      36 GQSFYAENNYTGALLELSEAEKLTPRDPDLLNLLGLTYYRKG 77  Geobacter bemidjiensis
jgi:Cyast_0908    52 GKEYIDSGDLNGALNAFRQASNIDETNARIFSGMGFLYASNG 93  Cyanobacterium stanieri PCC 7202
jgi:GEI7407_3778  32 GRELVQSGDLTGALAAYERAATLSQDNPRIFSGIGYVQARQG 73  Geitlerinema sp. PCC 7407
jgi:Anacy_3680   247 GDKYFQKGDYAAAINNYNQALQDKHQDANIYYKLGLVYHQLG 288 Anabaena cylindrica PCC 7122
WP_015080403     232 GDEYFQKGEYAAAINSYNQALQFNNSDADIYYKLGLVNYQLG 273 Nostocales
jgi:Npun_R1829   252 GDEYFEKGEYTNAIVNYGKALKVTSSDINLYYKRGLTHYQIG 293 Nostoc punctiforme PCC 73102
WP_011937625     379 ADIYTLRGSFPQAIEQYRELIKLRKDNPLIHFKLAKVYV-NS 419 Geobacter uraniireducens
P73762           124 GNAYFQKGQYDQAVEVLLAGLAQRPDTPAALFDLGNAYLKLV 165 Synechocystis sp. PCC 6803
jgi:Deba_0991    118 GDIYRIGGRNDKAIDVLLRACDVCNSADSLYYELGELYAKDG 159 Desulfarculus baarsii DSM 2075
WP_012448044     222 GNIYVDKEEQEKALTNYLRACDYTESFPDIYFNCGAIYFNLG 263 Natranaerobius thermophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap