Conserved Protein Domain Family
Mg_chelatase_C

?
pfam13335: Mg_chelatase_C 
Magnesium chelatase, subunit ChlI C-terminal
This is a family of the C-terminal of putative bacterial magnesium chelatase subunit ChlI proteins. Most members have the associated pfam01078.
Statistics
?
PSSM-Id: 379125
View PSSM: pfam13335
Aligned: 712 rows
Threshold Bit Score: 61.2512
Threshold Setting Gi: 524628934
Created: 4-Jun-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCW35273              410 SEAIRERVCRARRIQSQRFaqplpqnakppsgekatppepptrriycNAQMGPRELRAYCPLRPEVKTLLRAAIQQLGLS 489 Chthon...
HuoZJU:KKY_3377       404 SVVVAQRVAAARDIQRRRYagldl------------------sgvhtNSAAPSSAIEQIVAPDGESRDLLLKAAETFSLS 465 Pelagi...
jgi:Hbal_3102         401 SAEVAERVSKARLLQEERYrevsg-------------------arrlNVDADTQAIDAFCTPEQSGLDLLMQAAQKLNLS 461 Hirsch...
AGO_pseu:PSE_0380     411 SETVGQRVARARAIQQARYaslgl-------------------ditvNAHASARIIEQIVALDNGSKELIEQASIQFGLS 471 Pseudo...
TriplettUF:B488_05460 405 SQSVAERILKARQYQQQRMekmgi------------------ssvtnNAHCSVALIEQIAVPDSQGVLLLNEAAEKMHFS 466 Liberi...
WP_007557528          405 SITVADRVLIARNRQKERLekmgv-------------------tstcNALCSAKLIEQIAVLDSKSSSIIKQSAQKMLFS 465 Candid...
Q5NM12                402 SATVKARVMAARHIQSQRYqdykd------------------gtircNAEADGALIEKLTPMDDAARKILMTAVEKMHLS 463 Zymomo...
CCZ21901              404 SAAVKERVLSARERQKERYarseag-----------------ekiskNADASGNLLEKTALATDDALAFLLKAAEKMQLS 466 Acetob...
CDB39450              403 SAAIRERVIRAREIQKQRFielde------------------pqlstNAQLRGRLLEEVTRLDKDAEELLINFAHKNQLS 464 Azospi...
CCZ30459              414 SAAIRQRVIKAREIQTARFrqlge------------------kklctNAQLKGKLLEEVTALDNDAKELLVTFADRNKLS 475 Proteo...
CCW35273              490 ARAYDRLLKVARTIADLCGSEEVQTAHVAEAIQYR 524 Chthonomonas calidirosea T49
HuoZJU:KKY_3377       466 ARAYHRVLKVARTLADLAGSETVARPHIAEALSYR 500 Pelagibacterium halotolerans B2
jgi:Hbal_3102         462 ARGYHRVLKVSRTIADLDGSQLVRRIHVAEALNYR 496 Hirschia baltica ATCC 49814
AGO_pseu:PSE_0380     472 ARGYHRVLKLSRTIADMDGSDKVQRIHLAEALSFK 506 Pseudovibrio sp. FO-BEG1
TriplettUF:B488_05460 467 ARGYHRILKVARTIADLDQSEIVKSIHLAEAIAYR 501 Liberibacter crescens BT-1
WP_007557528          466 ARGYHKILKVAKTIADLDSSEIIKTIHIAEAIAYR 500 Candidatus Liberibacter americanus
Q5NM12                464 ARAYYRLLKVARTIADLDRAETLNQIHISEALSYR 498 Zymomonas mobilis
CCZ21901              467 ARAYHRILRVARTIADLEQNDRILTAHIAEALSFR 501 Acetobacter sp. CAG:977
CDB39450              465 ARAYHRTLRLARTIADLQSSVNVLKIHIAEALSYR 499 Azospirillum sp. CAG:260
CCZ30459              476 ARAYHRTLRLARTIADLQNESKILKLHIAEALSYR 510 Proteobacteria bacterium CAG:495
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap