6FWR


Conserved Protein Domain Family
Helicase_C_2

?
pfam13307: Helicase_C_2 
Click on image for an interactive view with Cn3D
Helicase C-terminal domain
This domain is found at the C-terminus of DEAD-box helicases.
Statistics
?
PSSM-Id: 379116
View PSSM: pfam13307
Aligned: 99 rows
Threshold Bit Score: 123.837
Threshold Setting Gi: 74979443
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6FWR_A          527 EQVESKKHLGMLVLFASGRAMQRFLDYV------TDLRLMLLVQ----GDQPRYRLVELHRK-RvanGERSVLVGLQ--- 592 Escherichia ...
Q880W4          591 ATQFAARPGNYLAFFSSFDYLLQVAELMar--thPH--ITLWQQargmAEGERHAFLERFTL-----SSQGIGFAVLg-- 659 Pseudomonas ...
jgi:Ccel_0660   595 WSSISKRTGNYVVFFPSYKYMNEVYTRFte--qyPETNTIIQETs--mTEEERESFLNRFQS-----GTEKSLVSFGvlg 665 Ruminiclostr...
CBK74961        613 QTIVNAKQGNYMVFGPSYKFLEDIVTEYqa--fgDDVDILIQQQn--mTEQEREDFLLEFET-----KRDKSMVAFCtlg 683 Butyrivibrio...
jgi:GYMC10_6000 591 SALVQEKPANTLIFLPSYPYMQDIHEAFar--mnPEARTLLQGHg--mSEEEREAFLNAFQAdA---EDPLIGFAVMg-- 661 Paenibacillu...
jgi:Clocel_0656 589 ILTAKSKIGNYMVFFPSYKYMEMVYESFleretgLTSKIQGSSM----TEEEKEEFLGAFKNdP---EESYIGFCVLg-- 659 Clostridium ...
jgi:Cphy_0224   665 EGFVNAKVGNYFVFFPSYQMLQQIAQLSed--riPNLLLQKTSM----GELEKEEFLAAFEEnP---TNTKVGYCVMg-- 733 Lachnoclostr...
Q2SNK0          597 HQTIASRPGNYWTFTPAFSYMEQLTERFaa--lyPEVEFVQQTRq--aSQEDQQRFLARFRK-----ARNLLGFTVIg-- 665 Hahella chej...
WP_118315140    171 elCLEKKAGNYMIFFPSYEMLTSVYGMAkq--snLALVSELIVQepsmEERSREAFLEKFREqS---GKPLIGFCVLg-- 243 [Eubacterium...
CDE21776        591 yAAITQRNGNYILFAPSYAYMKQLYEHFik--syP--DIDVFYQqqdmTEEEKQTFLAQFQI-S---KHLRLYFCVCg-- 660 Eubacterium ...
6FWR_A          593 -SFAEGLDLKGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHGCWGEVVIYD 671 Escherichia ...
Q880W4          660 gAFGEGIDLPGARLIGAFIATLGLPQL-NPVNEQFKQRMAALFGAGYDYTYLYPGVQKVVQAAGRVIRSQSDSGVVMLID 738 Pseudomonas ...
jgi:Ccel_0660   666 gIFSEGIDLKGDRLIGAIIVGVGLPQV-SPEQNIIMDYFKNKNRMGFENAYMYPGMNKVLQAAGRVIRSEHDVGTVILLD 744 Ruminiclostr...
CBK74961        684 gIFSEGIDLVGGKLIGSIILGAGLPQVGNQR-KLMSDFFDEQGKNGFEYAYLYPGMNKVIQAAGRLIRTKDDVGVIALLD 762 Butyrivibrio...
jgi:GYMC10_6000 662 gIFSEGIDLKGERLSSVVVIGVGLPQL-SFENDIIKDYFDRTGKRGYDYAYVYPGMNKVLQAGGRLIRSEQDSGTLTLVD 740 Paenibacillu...
jgi:Clocel_0656 660 gHFSEGIDLTYDRLIGVIIVGVGMPQIGIDR-DIIKDYFNEKEGTGFDYAYTYPGMIKVLQAVGRCIRTEEDKGVIVLID 738 Clostridium ...
jgi:Cphy_0224   734 gIFSEGIDLKKDRLIGAVIVGTGLPQVGNER-ELFRGYYDDRNGSGFDHAYLYPGINKVLQSAGRVIRTVEDKGAILLLD 812 Lachnoclostr...
Q2SNK0          666 gVYGESIDMVGDSLVGCIILGPGLPQI-SPVNEQVSAYFERQGMDGFAYAYQLPGWQKVVQAAGRVIRTELDKGVVILVD 744 Hahella chej...
WP_118315140    244 sIFSEGIDLTGNSLIGVLIVGTGLPQICNER-EVIRAYFDRQQKKGYDYAYRYPGMNKVLQAAGRVIRTAEDVGTILLMD 322 [Eubacterium...
CDE21776        661 gMFSEGIDLKGDALIGVILVGVGLPQI-NPYSDLIRQHFDEENQQGYAYAYQYPGMNKILQSAGRLIRSHEDKGILLFID 739 Eubacterium ...
6FWR_A          672 KRLLTKNYGKRLLDALP 688 Escherichia coli CFT073
Q880W4          739 DRFAERKVAQLFPAWWR 755 Pseudomonas syringae pv. tomato
jgi:Ccel_0660   745 ERFSNGNYRRLFPKHWE 761 Ruminiclostridium cellulolyticum H10
CBK74961        763 ERFRFGSYRKTFPREWN 779 Butyrivibrio fibrisolvens 16/4
jgi:GYMC10_6000 741 DRFLNRQYGMLLPEEWR 757 Paenibacillus sp. Y412MC10
jgi:Clocel_0656 739 TRYGQRRYTQLFPAEWR 755 Clostridium cellulovorans 743B
jgi:Cphy_0224   813 ERFLNSQYKNLFPREWE 829 Lachnoclostridium phytofermentans ISDg
Q2SNK0          745 DRFTKPPYPALEPQHWR 761 Hahella chejuensis KCTC 2396
WP_118315140    323 ERFLERDNQSLLPEEWE 339 [Eubacterium] hallii
CDE21776        740 ERYTSLHYRGALPSHLH 756 Eubacterium dolichum CAG:375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap