2O1X


Conserved Protein Domain Family
DXP_synthase_N

?
pfam13292: DXP_synthase_N 
Click on image for an interactive view with Cn3D
1-deoxy-D-xylulose-5-phosphate synthase
This family contains 1-deoxyxylulose-5-phosphate synthase (DXP synthase), an enzyme which catalyzes the thiamine pyrophosphoate-dependent acyloin condensation reaction between carbon atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate, to yield 1-deoxy-D- xylulose-5-phosphate, a precursor in the biosynthetic pathway to isoprenoids, thiamine (vitamin B1), and pyridoxol (vitamin B6).
Statistics
?
PSSM-Id: 379109
View PSSM: pfam13292
Aligned: 189 rows
Threshold Bit Score: 294.3
Threshold Setting Gi: 74992804
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O1X_A          13 LDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRILFDVGHQAYAHKILTG 92  Deinococcus r...
jgi:Sros_3712   35 LPRINGPGDLRRLPPGRLPELAGEIRRFLVDKVSATGGHLGPNLGAVELSIALHRVFASPRDAIVFDTGHQAYVHKILTG 114 Streptosporan...
A1SKM6           4 LDSIASPADLRGLSDAQLEQLASEIRDLLIRTVATNTGHLGPNLGVVELTLAIHRVFDSPRDRVVFDTGHQAYVHKLVCG 83  Nocardioides ...
jgi:Sked_16320   4 LETIASPADLRRLSPAQLDQLAAEIRTFLVQSVSRTGGHLGPNLGVVELTIAMHRVFASPTDSFVFDTGHQSYVHKLLTG 83  Sanguibacter ...
jgi:Bcav_1958    8 LPTVTTPRDLRRLKPAQLDALAAEIRDFLVTEVSKTGGHLGPNLGVVELTIALHRVFSSPTDRLVFDTGHQAYVHKLLTG 87  Beutenbergia ...
jgi:Xcel_1898    4 LAGISSPADLRRLKPQQLPALAAEIRDFLVHNVSRTGGHLGPNLGVVELTLALHRVFESPKDTFVFDTGHQSYVHKLLTG 83  Xylanimonas c...
jgi:Jden_1399    4 LDEVGSPTDLKRLSQDQVQDLAQEIRDYLVKSVSLTGGHLGPNLGVVELTLAMHRVFHSPKDSFIFDTGHQSYVHKLVTG 83  Jonesia denit...
Q4Z4K8         141 LKIINTPTDLKNLKKIYLPLLSHELKIFHFFLVNITGGHFSPSLSLLELQLSLLYIFNPPLDEIIYDIGHQTYIHKILTG 220 Plasmodium be...
WP_118232864     3 LEKITDPSFLKELDIRQLNQLADDIRKFLINNISKTGGHLSSNLGVVELSIALHYVFNSPKDKIFFDVGHQSYVHKILTG 82  Erysipelatocl...
WP_012669603     3 LESINTPSDIKNLDIEQLKSLSSEIREFLINNVSNTGGHLGSNLGVVDLTIVLHYLFDSPKDAFIFDVGHQSYTHKILTG 82  Brachyspira h...
2O1X_A          93 RRDQMADIKKEGGISGFTKVSESEHDAITVGHASTSLTNALGMALA------RDAQG-K---------D-----FHVAAV 151 Deinococcus r...
jgi:Sros_3712  115 RQGGFDRLRQAGGLSGYPSRAESVHDLVENSHASTALSYADGLARA------FQLRGhT---------D-----RHVVAV 174 Streptosporan...
A1SKM6          84 RAASFGTLRREGGVSGYPSQAESPHDIVENSHASTALSYADGLAKA------YTIRG-E---------D-----RHVIAV 142 Nocardioides ...
jgi:Sked_16320  84 RQN-FGDLRRREGLSGYPSRAESVHDIVENSHASTALSWADGIAKA------NVVRG-Lh--------D-----RHVVAV 142 Sanguibacter ...
jgi:Bcav_1958   88 RQD-FSRLRGRGGLSGYPSRAESDHDVVENSHASAALSWADGIARA------NQVAG-Lr--------D-----RHVVAV 146 Beutenbergia ...
jgi:Xcel_1898   84 RQD-FSALRKQGGLSGYPSRTESEHDVVENSHASTALSWADGIARA------NQVRG-Fd--------D-----RHVIAV 142 Xylanimonas c...
jgi:Jden_1399   84 RRD-FSNLRKQDGLSGYPSRAESDHDVVENSHASTALSWADGIARA------NVVRG-Id--------D-----RHVVAV 142 Jonesia denit...
Q4Z4K8         221 RKLLFLSLRQKNGISGFLNIFESIYDKFGAGHSSTALSAIQGIYEAdwqvlhSNKKGnDilknednydRnctpnKFYISI 300 Plasmodium be...
WP_118232864    83 RAGQFSTLRQYKGLSGFQKRCESEHDPWEAGHSSTALSGALGMAVA------RDLNH-E---------N-----YHILPV 141 Erysipelatocl...
WP_012669603    83 RKDKFNTLRTYGGISGFPKRIESEHDIEETGHSSTSLSFAYGLACS------KELLG-L---------R-----GDVIAI 141 Brachyspira h...
2O1X_A         152 IGDGSLTGGMALAALNTI-GDMG-RKMLIVLNDNEMSISE----------NVGAMNKFMRGLQVQKWFQEGEGAGKKAV- 218 Deinococcus r...
jgi:Sros_3712  175 IGDGALTGGLALEAVNNL-GAAPgRPAIIVLNDNGRSYAP----------TVGGLASHLATLRR---------------- 227 Streptosporan...
A1SKM6         143 IGDGALTGGMAWEALNNIaIAKA-SKLVIVVNDNGRSYTP----------TIGGLATALTSLRTNPRYENVLDLVKRRLn 211 Nocardioides ...
jgi:Sked_16320 143 MGDGALTGGMAWEALNNIaDGHD-RRLVLVVNDNGRSYAP----------TIGGMAHHLDTLRTTQGYESMLSWGRRTLr 211 Sanguibacter ...
jgi:Bcav_1958  147 VGDGALTGGMAWEALNNIsSGQD-RRLVVVVNDNGRSYSP----------TIGGLAQQLDTLRTTQSYERVLALGKATLq 215 Beutenbergia ...
jgi:Xcel_1898  143 IGDGALTGGMAWEALNNIaESED-RRVIIVVNDNGRSYSP----------TIGGLAHHLDTLRTTRGYEQFLGWGKRTLs 211 Xylanimonas c...
jgi:Jden_1399  143 IGDGALTGGMAWEALNNIaESDD-RRLVIIVNDNGRSYSP----------TIGGLARHLDTLRTTRQYEGMLSWGKRNLp 211 Jonesia denit...
Q4Z4K8         301 IGDGGLTGGMALEALNYI-SFLN-SKVLIIYNDNRQVSLPtngkcisgnkPIGAISDHL--------YDFVKKNGKIIGk 370 Plasmodium be...
WP_118232864   142 IGDAAMVGGESLEALNHL-GSIN-NKVIIILNDNQMAIGK----------SVGGFGDFLSSIRISGTYNNLKEDYRNITs 209 Erysipelatocl...
WP_012669603   142 IGDGAMTGGMALEAMNNI-AHTN-TDIIIVLNNNEMSIGK----------NIGAVSKFLNTTLNDSLVQEASEKVRGLVs 209 Brachyspira h...
2O1X_A         219 E--AV-SKPLADFMSRAKNSTRHFFDPasvNPFAAMGVRYVGPVDGHNVQELVWLLERLVDLDGPTILHIVT 287 Deinococcus radiodurans
jgi:Sros_3712  228 -------PGVPSPRPGV---------P---NVFESLGFSYLGPVDGHDIGALEGALRQARALRRPVVVHAVT 280 Streptosporangium ros...
A1SKM6         212 AvpGV-GPAAYDALHAMKKGLKDALAPq--gLFEDLGLKYVGPVDGHDRAAMEQVLAQAKRFNGPVIVHAIT 280 Nocardioides sp. JS614
jgi:Sked_16320 212 RsgPP-GRVAYDALHGLKKGIKDVVAPq--gMFEDLGIKYIGPVDGHDVGAVERALTSAKTFGAPVLVHVIT 280 Sanguibacter keddieii...
jgi:Bcav_1958  216 RggPP-GRFAYDALHGLKKGLKDVARPq--gLFEDLGIKYVGPVDGHDRVMVEHALRRAKAFDGPVIVHVIT 284 Beutenbergia cavernae...
jgi:Xcel_1898  212 RsgAP-GRFAFQALHGLKKGLKDVVMPq--gMFEDLGIKYIGPVDGHDEAAMERALQRARDFGAPVIVHAIT 280 Xylanimonas cellulosi...
jgi:Jden_1399  212 RlgIP-GQMLYDGLHGMKKGVKNIIRPq--gWFEDLGIKYLGPIDGHDLGDLEHAFRRAQAFGGPVLVHVIT 280 Jonesia denitrificans...
Q4Z4K8         371 --sNI------------NESDKNQ------NIFTNINYNYIGPIDGNNIENVIKILEDIKN-KG-----IQK 416 Plasmodium berghei
WP_118232864   210 Hn-KI-GKMIFNVSKRVKDFVKHGLIDd--TIFEDFGVDYLGPVNGHDFDDLIRVLNLAKSAKTSVVVHVVT 277 Erysipelatoclostridiu...
WP_012669603   210 --tLPfGDIANEFIDRGKGAIRTF-Vap-gIAFREMGFKYFGPVDGHNFEDLISTFQKVKSIRGPRLVQVNT 277 Brachyspira hyodysent...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap