2O1X


Conserved Protein Domain Family
DXP_synthase_N

?
pfam13292: DXP_synthase_N 
Click on image for an interactive view with Cn3D
1-deoxy-D-xylulose-5-phosphate synthase
This family contains 1-deoxyxylulose-5-phosphate synthase (DXP synthase), an enzyme which catalyzes the thiamine pyrophosphoate-dependent acyloin condensation reaction between carbon atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate, to yield 1-deoxy-D- xylulose-5-phosphate, a precursor in the biosynthetic pathway to isoprenoids, thiamine (vitamin B1), and pyridoxol (vitamin B6).
Statistics
?
PSSM-Id: 338670
View PSSM: pfam13292
Aligned: 190 rows
Threshold Bit Score: 291.988
Threshold Setting Gi: 74992804
Created: 30-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O1X_A        13 LDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRILFDVGHQAYAHKILTG 92  Deinococcus rad...
Q8EWX7         8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITD 87  Mycoplasma pene...
WP_015771680   4 LDEVGSPTDLKRLSQDQVQDLAQEIRDYLVKSVSLTGGHLGPNLGVVELTLAMHRVFHSPKDSFIFDTGHQSYVHKLVTG 83  Jonesia denitri...
WP_012878659   4 LAGISSPADLRRLKPQQLPALAAEIRDFLVHNVSRTGGHLGPNLGVVELTLALHRVFESPKDTFVFDTGHQSYVHKLLTG 83  Xylanimonas cel...
WP_015882453   8 LPTVTTPRDLRRLKPAQLDALAAEIRDFLVTEVSKTGGHLGPNLGVVELTIALHRVFSSPTDRLVFDTGHQAYVHKLLTG 87  Beutenbergia ca...
WP_012866636   4 LETIASPADLRRLSPAQLDQLAAEIRTFLVQSVSRTGGHLGPNLGVVELTIAMHRVFASPTDSFVFDTGHQSYVHKLLTG 83  Sanguibacter ke...
WP_012921353   4 LDTVGGPADLKDLTDQQLADLAAEIRDVLVETVSRTGGHLGPNLGMVEITLAMHRVFDSPRDRLVYDTGHQTYVHKLLTG 83  Kribbella flavida
WP_012890378  35 LPRINGPGDLRRLPPGRLPELAGEIRRFLVDKVSATGGHLGPNLGAVELSIALHRVFASPRDAIVFDTGHQAYVHKILTG 114 Streptosporangi...
WP_008791737   3 LEKITDPSFLKELDIRQLNQLADDIRKFLINNISKTGGHLSSNLGVVELSIALHYVFNSPKDKIFFDVGHQSYVHKILTG 82  Coprobacillus s...
WP_012669603   3 LESINTPSDIKNLDIEQLKSLSSEIREFLINNVSNTGGHLGSNLGVVDLTIVLHYLFDSPKDAFIFDVGHQSYTHKILTG 82  Brachyspira hyo...
2O1X_A        93 RRDQMADIKKEGGISGFTKVSESEHDAITVGHASTSLTNALGMALARDAQG-K-DFHVAAVIGDGSLTGGMALAALNTI- 169 Deinococcus rad...
Q8EWX7        88 RADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SkS--KSVIPVIGDAAISNGLAFEALNNI- 162 Mycoplasma pene...
WP_015771680  84 RRD-FSNLRKQDGLSGYPSRAESDHDVVENSHASTALSWADGIARANVVRG-IdDRHVVAVIGDGALTGGMAWEALNNIa 161 Jonesia denitri...
WP_012878659  84 RQD-FSALRKQGGLSGYPSRTESEHDVVENSHASTALSWADGIARANQVRG-FdDRHVIAVIGDGALTGGMAWEALNNIa 161 Xylanimonas cel...
WP_015882453  88 RQD-FSRLRGRGGLSGYPSRAESDHDVVENSHASAALSWADGIARANQVAG-LrDRHVVAVVGDGALTGGMAWEALNNIs 165 Beutenbergia ca...
WP_012866636  84 RQN-FGDLRRREGLSGYPSRAESVHDIVENSHASTALSWADGIAKANVVRG-LhDRHVVAVMGDGALTGGMAWEALNNIa 161 Sanguibacter ke...
WP_012921353  84 RAAEFGSLRQQGGLSGYPSQAESEHDIVENSHASTSLSYADGLAKAYRLRG-E-DRHVVALIGDGGLTGGMAWEALNNIa 161 Kribbella flavida
WP_012890378 115 RQGGFDRLRQAGGLSGYPSRAESVHDLVENSHASTALSYADGLARAFQLRGhT-DRHVVAVIGDGALTGGLALEAVNNL- 192 Streptosporangi...
WP_008791737  83 RAGQFSTLRQYKGLSGFQKRCESEHDPWEAGHSSTALSGALGMAVARDLNH-E-NYHILPVIGDAAMVGGESLEALNHL- 159 Coprobacillus s...
WP_012669603  83 RKDKFNTLRTYGGISGFPKRIESEHDIEETGHSSTSLSFAYGLACSKELLG-L-RGDVIAIIGDGAMTGGMALEAMNNI- 159 Brachyspira hyo...
2O1X_A       170 GDMG-RKMLIVLNDNEMSISENVGAMNKFMRGLQVQKWFQEGEGAGKKAV-E-----AV-SKPLADFMSRAKNSTRHFfD 241 Deinococcus rad...
Q8EWX7       163 AYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILfKkewskKI-YWSIYKSFSKLSKFFKGK-- 238 Mycoplasma pene...
WP_015771680 162 ESDD-RRLVIIVNDNGRSYSPTIGGLARHLDTLRTTRQYEGMLSWGKRNL-Prl--gIP-GQMLYDGLHGMKKGVKNIiR 236 Jonesia denitri...
WP_012878659 162 ESED-RRVIIVVNDNGRSYSPTIGGLAHHLDTLRTTRGYEQFLGWGKRTL-Srs--gAP-GRFAFQALHGLKKGLKDVvM 236 Xylanimonas cel...
WP_015882453 166 SGQD-RRLVVVVNDNGRSYSPTIGGLAQQLDTLRTTQSYERVLALGKATL-Qrg--gPP-GRFAYDALHGLKKGLKDVaR 240 Beutenbergia ca...
WP_012866636 162 DGHD-RRLVLVVNDNGRSYAPTIGGMAHHLDTLRTTQGYESMLSWGRRTL-Rrs--gPP-GRVAYDALHGLKKGIKDVvA 236 Sanguibacter ke...
WP_012921353 162 AARD-LKLVIIVNDNGRSYSATVGGLATHLTSLRTNPRYEKILDLVRTNL-Grt--pYV-GPPMYEVLHGVKKGLKDVlA 236 Kribbella flavida
WP_012890378 193 GAAPgRPAIIVLNDNGRSYAPTVGGLASHLATLRR--------------------------PGVPSPRPGVp-------- 238 Streptosporangi...
WP_008791737 160 GSIN-NKVIIILNDNQMAIGKSVGGFGDFLSSIRISGTYNNLKEDYRNIT-Sh---nKI-GKMIFNVSKRVKDFVKHGlI 233 Coprobacillus s...
WP_012669603 160 AHTN-TDIIIVLNNNEMSIGKNIGAVSKFLNTTLNDSLVQEASEKVRGLVsT-----LPfGDIANEFIDRGKGAIRTF-V 232 Brachyspira hyo...
2O1X_A       242 pasvNPFAAMGVRYVGPVDGHNVQELVWLLERLVDl--DGPTILHIVT 287 Deinococcus radiodurans
Q8EWX7       239 ----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNivpFGPTILHVKT 282 Mycoplasma penetrans HF-2
WP_015771680 237 pq--gWFEDLGIKYLGPIDGHDLGDLEHAFRRAQAf--GGPVLVHVIT 280 Jonesia denitrificans
WP_012878659 237 pq--gMFEDLGIKYIGPVDGHDEAAMERALQRARDf--GAPVIVHAIT 280 Xylanimonas cellulosilytica
WP_015882453 241 pq--gLFEDLGIKYVGPVDGHDRVMVEHALRRAKAf--DGPVIVHVIT 284 Beutenbergia cavernae
WP_012866636 237 pq--gMFEDLGIKYIGPVDGHDVGAVERALTSAKTf--GAPVLVHVIT 280 Sanguibacter keddieii
WP_012921353 237 pq--gMFEDLGLKYVGPVDGHDRAAMEDALAKAKAf--GGPVIVHAVT 280 Kribbella flavida
WP_012890378 239 ----NVFESLGFSYLGPVDGHDIGALEGALRQARAl--RRPVVVHAVT 280 Streptosporangium roseum
WP_008791737 234 d--dTIFEDFGVDYLGPVNGHDFDDLIRVLNLAKSa--KTSVVVHVVT 277 Coprobacillus sp. 8_2_54BFAA
WP_012669603 233 ap-gIAFREMGFKYFGPVDGHNFEDLISTFQKVKSi--RGPRLVQVNT 277 Brachyspira hyodysenteriae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap