Conserved Protein Domain Family
TPR_8

?
pfam13181: TPR_8 
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 338619
View PSSM: pfam13181
Aligned: 93 rows
Threshold Bit Score: 28.8936
Threshold Setting Gi: 121731705
Created: 30-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8A5L6        261 YGYYLVIGSAYLQLEQYDSASVYLNRGISSDNY 293  Bacteroides thetaiotaomicron
WP_013180295   44 YEIWNLMSSIYHELGRDNLAMQCITNALKLAPK 76   Methanococcus voltae
XP_019634444  327 GQACEAIAKSYESQGKIEESIQYLEAFVDVAER 359  Belcher's lancelet
WP_013157955  353 FEALMIQGKAAYQQGRHNEAQEALAQATQLKAD 385  Meiothermus silvanus
XP_001586839   38 YQANIFLGYAYSKSSKFTEAEEAYEAATKIREG 70   Sclerotinia sclerotiorum 1980 UF-70
XP_002516885  347 IPGYIMKGNLLLSLKRPEAAVIAFRGAQELRPD 379  castor bean
WP_011727956  141 PDSWVLRGDIYRALNWMAPAEADYREALRLQPD 173  Mycobacterium smegmatis
WP_012393375  145 VDAHVLRGSILHDLRRIEESTEAYRAALALDPG 177  Mycobacterium marinum
WP_013159712  277 QEAWWGYAHTLRLLGRVEEALAYLLRALALDLA 309  Meiothermus silvanus
XP_002305241  633 GEAWNNIACLHMIRKRSEEAFIAFNEALKFKRD 665  black cottonwood
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap