3MA5


Conserved Protein Domain Family
TPR_8

?
pfam13181: TPR_8 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 404131
View PSSM: pfam13181
Aligned: 92 rows
Threshold Bit Score: 27.7465
Threshold Setting Gi: 506310266
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MA5_B          41 VGTYYHLGKLYERLDRTDDAIDTYAQGIEVARE 73   Salinibacter ruber DSM 13855
XP_002287307  1113 VKMLVLSGQAHSSLGEMEVAISEFTRAISFPQS 1145 Thalassiosira pseudonana CCMP1335
Q2FQB4         169 VEAWVLKGTAHGGLAQYEEEINASERALQIEPA 201  Methanospirillum hungatei JF-1
jgi:Haur_0269  485 ARLLNNQGMIYAEQTNYEAARQAYEAALTIRQQ 517  Herpetosiphon aurantiacus DSM 785
XP_001586839    38 YQANIFLGYAYSKSSKFTEAEEAYEAATKIREG 70   Sclerotinia sclerotiorum 1980 UF-70
XP_001466250    41 ARALNNISACYAALKNYEMSSKVAREVISLQPG 73   Leishmania infantum JPCM5
WP_012658601   167 VSTYQRIGRAYAALGKFEAAIEFLEKANSIEYD 199  Streptococcus uberis
EFC47880       354 IKAYYRKAQSYQSLGELEESKTTLEQCVEVCAN 386  Naegleria gruberi
EEN56921       327 GQACEAIAKSYESQGKIEESIQYLEAFVDVAER 359  Florida lancelet
A0C105         198 IQANLRKLKVKILTNKIEEAEQIVKQLDGISLN 230  Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap