Conserved Protein Domain Family
TPR_8

?
pfam13181: TPR_8 
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 338619
View PSSM: pfam13181
Aligned: 93 rows
Threshold Bit Score: 28.8936
Threshold Setting Gi: 121731705
Created: 30-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30
                   ....*....|....*....|....*....|...
gi 81444261    261 YGYYLVIGSAYLQLEQYDSASVYLNRGISSDNY 293
gi 502945319    44 YEIWNLMSSIYHELGRDNLAMQCITNALKLAPK 76
gi 1126202117  327 GQACEAIAKSYESQGKIEESIQYLEAFVDVAER 359
gi 502922979   353 FEALMIQGKAAYQQGRHNEAQEALAQATQLKAD 385
gi 156039463    38 YQANIFLGYAYSKSSKFTEAEEAYEAATKIREG 70
gi 255551679   347 IPGYIMKGNLLLSLKRPEAAVIAFRGAQELRPD 379
gi 500047238   141 PDSWVLRGDIYRALNWMAPAEADYREALRLQPD 173
gi 501361809   145 VDAHVLRGSILHDLRRIEESTEAYRAALALDPG 177
gi 502924736   277 QEAWWGYAHTLRLLGRVEEALAYLLRALALDLA 309
gi 566165499   633 GEAWNNIACLHMIRKRSEEAFIAFNEALKFKRD 665
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap