Conserved Protein Domain Family
DUF3909

?
pfam13077: DUF3909 
Protein of unknown function (DUF3909)
This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 110 amino acids in length.
Statistics
?
Aligned: 2 rows
Threshold Bit Score: 199.928
Threshold Setting Gi: 228696691
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEL49507       1 MNLEKFDGMIDAVQRTTCMPINDKQQAAFKQKYDFEPTFEYGRDEDNHYVIRTSKKMLEEMEFYLALKYDREEIDLYMHA 80  Bacillus cereus...
WP_001047312   1 MNLEKFDGMIDAVQRTTCMPINDKQQAAFKQKYDFEPTFEYGRDEDNHYVIRTSKKMLEEMEFYLALKYDREEIDLYMHA 80  Bacillus cereus
EEL49507      81 EIDGVCYVSVSYEKEALHLQELFQFLED 108 Bacillus cereus Rock3-44
WP_001047312  81 EIDGVCYVSVSYEKEALHLQELFQFLED 108 Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap