Conserved Protein Domain Family
DUF3939

?
pfam13075: DUF3939 
Protein of unknown function (DUF3939)
This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 150 amino acids in length.
Statistics
?
PSSM-Id: 289820
View PSSM: pfam13075
Aligned: 9 rows
Threshold Bit Score: 169.07
Threshold Setting Gi: 81715235
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q81RM8        10 EEREITKDELEQAMAQFLEK-NANIVYTVLVNDDYTVNYDLLKPYLPAFPTNIFLITKETLEVFEhtEENLNLVKEIDIV 88  Bacillus anthracis
4_pfamImport   2 EISDLSIDEIRKAVHAFADHkPNEVPLSVVINQDLTLDYELLAPYLNAIPRKNFYMSRKTYELFE--EEDLQLAKDIDTV 79 
2_pfamImport   2 REIDITLSELRHAIHEYEQTlPKGVNRTVLLDDSQEIDTKRLKHHLSGIPKQRFFMSKETFHIVP--EDERDVIYEMDQV 79 
1_pfamImport   2 PVRDVTLDEVKRATHDFELAlPKGTNRTILLDQEQRIDMARLAPHLGVRSTQVFYMSRETFAIME--AKDRATVYEMDHV 79 
8_pfamImport   2 RLITVTLPEVKQAVRQFEKDmPAAINRTVLMKDDKSIDLSRLARYLGGKTEQKFYMSRETFEIFE--EAEKDIPYFLDMV 79 
WP_015592395 180 PIIESTLYDVRYAVRQFSDDlPKGINRTILVKEDNSINFDRLAPYLHGIPSKPFYMSKETFDIFE--EKDKNIPPIIDKV 257 Bacillus sp. 1N...
WP_015592279 185 PFVQVSLDEVRNAIRNFSEHlPKGTFRTILVNDDFTIDFSQLVPYLPGIPSQKFYMSKETYDVFD--ESEKEIPEIMDKV 262 Bacillus sp. 1N...
WP_015593295 135 fkDEITKEDVIKAVRKFSDNlPQGTYRTILVNDDYSIDFSQLRRYLPRTPTQKFYLSKETYDIFE--EHEKHIPPLMDKV 212 Bacillus sp. 1N...
WP_013487595  20 KIVTVTIDEVRAAVNKYANNmQKGISLRSIVLDNNEIDFEALYSYLGGKPDRPFYMSKETFEIFE--E--KDYPKYIDLC 95  Bacillus cellul...
Q81RM8        89 QKAVDQYVTEKEMFPIVEGSEDRLICGMKL--GPYLDRILKRDLYISEKHYLVSS 141 Bacillus anthracis
4_pfamImport  80 QQAVDEYMKQTQEVPVIDNDPYKRINYYKLekLDLLPERPKRDFYMTTEEFMITY 134
2_pfamImport  80 QRALDLYMDQEKKLPLQKFQNALQLDLTCLreGGYLKTLPKRPYYVVDETLIVSL 134
1_pfamImport  80 QVAVDRYFDKERKLPLKPYSKTFQVDCAKLfeQGYLRELPHHTYYLVDESMIVSL 134
8_pfamImport  80 QLAVDNYISDTGKLPLREEASLPEVHYHLLssQRYLKETPPFPLYITADELMLTH 134
WP_015592395 258 QKAVNLFYKKNNAYPAMPYDSLHRVNYFQLlqDHYLDEMPGIELYITEYHGLLTH 312 Bacillus sp. 1NLA3E
WP_015592279 263 QKAVDHYFKDHKQYPTLSYDPLHRVNFFELiqGKYLDFNPELEFYITDYDGIISH 317 Bacillus sp. 1NLA3E
WP_015593295 213 QKAVDQYVKEHNEYPTLPYDHLRRVNTFLLvqEHLLEEVPNIEFYITNYDGLITH 267 Bacillus sp. 1NLA3E
WP_013487595  96 QIACDQYILENGEEPITTGDPERKVNFQKL--KHYLTEKPPFKLYLHPQDRMVTH 148 Bacillus cellulosilyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap