5J9Q


Conserved Protein Domain Family
ING

?
pfam12998: ING 
Click on image for an interactive view with Cn3D
Inhibitor of growth proteins N-terminal histone-binding
Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes. Inhibitor of growth proteins (INGs) specifically bind to residues that have been thus modified. INGs carry a well-characterized C-terminal PHD-type zinc-finger domain, binding with lysine 4-tri-methylated histone H3 (H3K4me3), as well as this N-terminal domain that binds unmodified H3 tails. Although these two regions can bind histones independently, together they increase the apparent association of the ING for the H3 tail.
Statistics
?
Aligned: 74 rows
Threshold Bit Score: 63.6902
Threshold Setting Gi: 259016421
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5J9Q_D         6 VLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEqkeSQIHKFIrq----------qGSIPKHPQEDGLdKEIKES 75  Saccharomyces c...
XP_001485850  36 GLNDISDAFEALPMDLIKYFTLLKEIDAKCINTIPQIN---GHIKKYLd------------EVHADGVTPKRL-ETIGHK 99  Meyerozyma guil...
Q6BM01        27 GLNDISDAFEALPLDLIKYFTLLKEIDAKYINTVPVIN---RNIKSYIdrlhitknsppgmKEMNKPTKIDKL-TVIRDK 102 Debaryomyces ha...
CAR26425      10 GLNDIVDVLEEFPVESSRYLTLLHEIDAKCVHSTPQLN---KEIDRFI-------------SKSNVSNASQNL-ANINQL 72  Zygosaccharomyc...
Q6FSZ9        10 GLNDIVDVLEELPLEISRYFTLLHEIDAKCVLAGPALD---DKIKGFLendp-----tekqDEIAQKDKLQSL-VSINQF 80  [Candida] glabrata
EDO15236      10 GLADITDVLEEFPVETSRYLTLLHEIDAKCVHTLPGLH---ANIDRFVgs----------kGDKEGGNKLDTL-GVINRL 75  Vanderwaltozyma...
P50947        10 GLNDITDVLEEFPLATSRYLTLLHEIDAKCVHSMPNLN---ERIDKFLkk----------dFNKDHQTQVRLL-NNINKI 75  Saccharomyces c...
Q75B40        36 GLNDSVDVIEEFPLEVARYMTLLREIDAKCVHTVPELN---AQIGRFL--------------AGSRQPGSPQL-QTINRL 97  Eremothecium go...
CAR22660      10 GLNDISDVLEEMPLEVTRYLTLLREIDAKCVHTVPELN---STIGEFLg------------ARGSKNDGVEPL-ARMNGL 73  Lachancea therm...
Q6CTE1        10 GLNDISDVLEEVPLDVSRYMTLLYEIDAKCVNIIPELN---KCIKGFLg------------GRNVPDESKVPL-RVINQW 73  Kluyveromyces l...
5J9Q_D        76 LLKCQSLQREKCVLANTALFLIARHLNKLEKNIALL 111 Saccharomyces cerevisiae S288C
XP_001485850 100 IHEIIPCLEEKMHVTTVATDVLYKHMHRINNDYQMI 135 Meyerozyma guilliermondii ATCC 6260
Q6BM01       103 IHEIIPCLEEKMHVTSVATDLLHKHLYRINADYKLI 138 Debaryomyces hansenii
CAR26425      73 FQELMPSLEEKMHVSSIMLESLQHLTSRLELDYEIA 108 Zygosaccharomyces rouxii
Q6FSZ9        81 LEELMPSFEEKMHVSSIMLESLQRLTSRMELAYEVA 116 [Candida] glabrata
EDO15236      76 FEELIPSLEEKMHVSSIMLKTMEDLTERLELAYEVA 111 Vanderwaltozyma polyspora DSM 70294
P50947        76 YEELMPSLEEKMHVSSIMLDNLDRLTSRLELAYEVA 111 Saccharomyces cerevisiae S288C
Q75B40        98 FQDLMPSLEEKMHVSSIAFETLDRLVARVELAYEVA 133 Eremothecium gossypii
CAR22660      74 FQDLMPSLEEKMHVSALAYEALNRLTARLELAYEVA 109 Lachancea thermotolerans CBS 6340
Q6CTE1        74 FQELIPSLEEKMHVSSIAYDSLERLTDRLELAYEVA 109 Kluyveromyces lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap