5J9Q


Conserved Protein Domain Family
ING

?
pfam12998: ING 
Click on image for an interactive view with Cn3D
Inhibitor of growth proteins N-terminal histone-binding
Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes. Inhibitor of growth proteins (INGs) specifically bind to residues that have been thus modified. INGs carry a well-characterized C-terminal PHD-type zinc-finger domain, binding with lysine 4-tri-methylated histone H3 (H3K4me3), as well as this N-terminal domain that binds unmodified H3 tails. Although these two regions can bind histones independently, together they increase the apparent association of the ING for the H3 tail.
Statistics
?
PSSM-Id: 338577
View PSSM: pfam12998
Aligned: 75 rows
Threshold Bit Score: 62.9101
Threshold Setting Gi: 259016421
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5J9Q_D         6 VLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEqkeSQIHKFIrq--------qGSIPKHPQEDGLdKEIKESLL 77
gi 74637668   10 GLNDIVDVLEELPLEISRYFTLLHEIDAKCVLAGPALD---DKIKGFLendp---tekqDEIAQKDKLQSL-VSINQFLE 82
gi 1730755    10 GLNDITDVLEEFPLATSRYLTLLHEIDAKCVHSMPNLN---ERIDKFLkk--------dFNKDHQTQVRLL-NNINKIYE 77
gi 74694604   36 GLNDSVDVIEEFPLEVARYMTLLREIDAKCVHTVPELN---AQIGRFL------------AGSRQPGSPQL-QTINRLFQ 99
gi 74636903   10 GLNDISDVLEEVPLDVSRYMTLLYEIDAKCVNIIPELN---KCIKGFLg----------GRNVPDESKVPL-RVINQWFQ 75
gi 74633858   23 GLNDLTDALEALPLETVRHFTLLREIDAKCTTTTPLVA---DLIAKFLaippaakddpeCAKKTEERENML-LEIRGLIR 98
gi 255713632  10 GLNDISDVLEEMPLEVTRYLTLLREIDAKCVHTVPELN---STIGEFLg----------ARGSKNDGVEPL-ARMNGLFQ 75
gi 156838790  10 GLADITDVLEEFPVETSRYLTLLHEIDAKCVHTLPGLH---ANIDRFVgs--------kGDKEGGNKLDTL-GVINRLFE 77
gi 254578744  10 GLNDIVDVLEEFPVESSRYLTLLHEIDAKCVHSTPQLN---KEIDRFI-----------SKSNVSNASQNL-ANINQLFQ 74
gi 254574018  49 GLNDITDSFEAFPLELIRYFTLLKEIDAKTVQSVPLLI---TYIKRFLq----------MSKTHPKREQLL-HEIRELIK 114
                         90       100       110
                 ....*....|....*....|....*....|....
5J9Q_D        78 KCQSLQREKCVLANTALFLIARHLNKLEKNIALL 111
gi 74637668   83 ELMPSFEEKMHVSSIMLESLQRLTSRMELAYEVA 116
gi 1730755    78 ELMPSLEEKMHVSSIMLDNLDRLTSRLELAYEVA 111
gi 74694604  100 DLMPSLEEKMHVSSIAFETLDRLVARVELAYEVA 133
gi 74636903   76 ELIPSLEEKMHVSSIAYDSLERLTDRLELAYEVA 109
gi 74633858   99 ELMPCLEEKMHVAGVAAEAVARHISRIDADYELI 132
gi 255713632  76 DLMPSLEEKMHVSALAYEALNRLTARLELAYEVA 109
gi 156838790  78 ELIPSLEEKMHVSSIMLKTMEDLTERLELAYEVA 111
gi 254578744  75 ELMPSLEEKMHVSSIMLESLQHLTSRLELDYEIA 108
gi 254574018 115 ELMPCLEEKMHVATIAADAVARHVKRIDSDFELI 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap