3N5L


Conserved Protein Domain Family
Phosphonate-bd

?
pfam12974: Phosphonate-bd 
Click on image for an interactive view with Cn3D
ABC transporter, phosphonate, periplasmic substrate-binding protein
This is a family of periplasmic proteins which are part of the transport system for alkylphosphonate uptake.
Statistics
?
PSSM-Id: 379006
View PSSM: pfam12974
Aligned: 103 rows
Threshold Bit Score: 123.141
Threshold Setting Gi: 147851820
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3N5L_A           8 FGIISTESSQNLKSIWEPFLKDXSQQT---GYQ--VKAFFAPDyAGIIQGXRFDKVDIAWYGNKAAXEAVDR-A-HgEIF 80  Pseudomonas a...
jgi:Hoch_3402   87 VGVHTWELSSRVDQDYAAIAQAFEQALgaiGQPsaVDIEPFAVyGELTEALLAGRIDVARLESATYLEVRER-G-QlPLL 164 Haliangium oc...
jgi:Mmc1_3404   30 FGVHPFLPATELHKRFQPLITFLMHEL---QRP--VQFHVAANyAEHLKNLVDNQIDIAYLGPYPYIKLVHD-FtQpRLL 103 Magnetococcus...
jgi:Mmc1_3535   30 LAIHPYLSRDELLHRFTPLADYLAEHL---HRP--VAVRIGTSyQDHLYHIAHDKVDLALLGPAAYVDMFQQ-Y-GkKPL 102 Magnetococcus...
jgi:Mmc1_0734   31 LGFMPYLSSASLLEKYTPLVRYLGEQL---GRP--VHIKIARNyQEHIEQIGENKLDIAFLGGSPYVAVTDH-Y-GkKPL 103 Magnetococcus...
jgi:Gura_2753   34 FGVNLRYNPISMYKRYQPLMDYLTQNT---PYR--FELKISRDyLETLRFLKYGTTQLGFLGDIAFVEARLR-F-GaVPI 106 Geobacter ura...
jgi:Glov_3443   34 YTPLPIEQPETVIAANRPLVSYLAKQL---KTP--IAIRYEKNyEDILRLFQEGKIDIVHLGPLPYVILRNS-YtKaESL 107 Geobacter lov...
Q0A563          33 FAPLPMQDAEAVVREFRPLLAFLEARL---GVR--FEIDYSTDyGEILEKFRSGEVDLAYLGPLPYVELRDR-DdAvEPL 106 Alkalilimnico...
CDK98150        27 FAPLPMETPETVVKQVKPMLNHLEKAL---DIQ--VKIEFSSDyAEILSKFESGKLDLAYLGPLPYLTLRDRvA-AaTPL 100 Magnetospiril...
jgi:Desal_2373  52 YAYLPQYSHRVSYLRHSKLIDYLSRES---GFT--IRQVFPDTfEEHRRMVKDGEIDISFSNPMTYVSIAQ--N-GaRAF 123 Desulfovibrio...
3N5L_A          81 AQTVAASGAPGYWSLLIANKDSK-IDSLEDxlanAKSLTFGNGDPNSTSGYLVPGYYvF-AkNNVDPVKAFKRT-LN--- 154 Pseudomonas a...
jgi:Hoch_3402  165 ALEQ-PAMATPRRAVVVTAADSA-IASLAD----ARGHSFAFGDQRTAVGRYLPQAA-L-ReAGVEAEALSRSR-YM--- 232 Haliangium oc...
jgi:Mmc1_3404  104 AQL-RVNGENAYHGVIFTYEKAS-LQSLAD----LRGKRMAFGDVDSTMSHLIPLKM-L-QqAGVKKVDLGGFQ-HV--- 171 Magnetococcus...
jgi:Mmc1_3535  103 LTRFAIKGIPYFHGYIVVRKDSP-IKQLED----LKGHLFAFGDPKSTMSHLVPRSM-L-ReKGITVSALSGYA-FL--- 171 Magnetococcus...
jgi:Mmc1_0734  104 LVRYAFDGTPYFRAVIVVSNNSP-ITSLDQ----LAGKRMAFGNINSTLSSQVPLYM-Im-qKGVRLAQLATYK-HL--- 172 Magnetococcus...
jgi:Gura_2753  107 LMPLREDGRPSYRSAIVVPRISP-LNSLQD----LKGKKVAFGNLHSTSGNLFPRYL-LlSk-RVYMQELGSFT-NL--- 175 Geobacter ura...
jgi:Glov_3443  108 VAINEPDGKATYTCAMVTAFDGP-L-SVEQ----V-RRSIAFSQPLSTCGHLTAGYL-L-DkHGVKLEAL-HHD-YL--- 173 Geobacter lov...
Q0A563         107 VVFREPDGQAHYTCSVVMFAD-D-RQPLGA----LAGQSVALTQPLSTCGYLAVKAL-L-RpAGVRLEHT-RYD-YL--- 173 Alkalilimnico...
CDK98150       101 VHFKEASGSATYTCAIVAAADAK-T-DLAK----VKGRKVALTQPLSTCGYLSTDGL-L-RqAGSSLEDN-KYR-YL--- 167 Magnetospiril...
jgi:Desal_2373 124 ARIIEPSGSPTFRGQIITRKDNRaITRLKD----CIGKTWIAVDPLSAGGYLFPLG--LfLkNGIKES-DFKEIsFApgp 196 Desulfovibrio...
3N5L_A         155 -SSHEVNALAVANKQVDVATFNTEGXERLELTQpEKARQLKVIWKSPLIpGDPLVW-R-NN-LSDEQKNKLRDFFFKYGA 230 Pseudomonas a...
jgi:Hoch_3402  233 -RRPDKIAAAVRLGEYDLGVLSYALYRREARAG-----TLRVVATIDDApQ-PWVA-R-RG-LEPSLLRGLADALQAMDA 302 Haliangium oc...
jgi:Mmc1_3404  172 -NNHLNVVYGVLTGLFDAGATKESTYHQYAAWG------LRVLARSPAVpNHVLVA-R-AT-LPNAHIEAVKAALAKIGS 241 Magnetococcus...
jgi:Mmc1_3535  172 -GSHQNVALAVLAGDFDAGAIKEEVYQTFKTRG------LRVLATTPAFsEHLFVA-R-ST-LDEVLVQQVRQIMLDMYQ 241 Magnetococcus...
jgi:Mmc1_0734  173 -RNHENVLLGVAFGEFDAGAVAEEVYRESM--G----LDLHLLATSPLLsTHLFVT-R-SD-MPAALQARIRQLLMQLHT 242 Magnetococcus...
jgi:Gura_2753  176 -RNHDEVARAVLRGEYDAGAVNDITAEKYRKEG------LRVLAYSNPIpTAPIVV-R-GD-APKQLVKAVTDALLMLDR 245 Geobacter ura...
jgi:Glov_3443  174 -GNQDQVALAVVKGTYEVGTLKTAVAKKYASL------TLRIIEETPAFpGFLLVAnR-AT-VTPEQIREIRKLLLGIAS 244 Geobacter lov...
Q0A563         174 -GRHDEVALAVVRGDYQAGGMKTHIARRYEHLGl------VRVAETGPLpGFALVA-NaRT-VTPELQAGLRGALMSVHP 244 Alkalilimnico...
CDK98150       168 -DKHDEVALAVIRGEFDLGGLKTAIGRKYAHMG------LLVVAESAPLpGFALVA-N-AKtVSKERMNQLRDALVGMDS 238 Magnetospiril...
jgi:Desal_2373 197 gGKQEKAVLAVYAGKYDFASIREGTLNVVRDK--INIDKIRIVAETEPFpGWVYAA-R-KG-LSEKVVDKIKYCMFRMSM 271 Desulfovibrio...
3N5L_A         231 -N--AEQKKVLADL--Q---WS---KFQASDDDQL 254 Pseudomonas aeruginosa PAO1
jgi:Hoch_3402  303 -------SRSLRSL--G---IV---GFTAPDASVY 322 Haliangium ochraceum DSM 14365
jgi:Mmc1_3404  242 -G--TLDTLILKPLkpN---IT---GLGPVTDADF 267 Magnetococcus marinus MC-1
jgi:Mmc1_3535  242 -S--PQGRAVLTGIkaN---LT---ALVPVHNEDY 267 Magnetococcus marinus MC-1
jgi:Mmc1_0734  243 -T--EQGLGVLQSInrK---LT---AFVSVKDSDY 268 Magnetococcus marinus MC-1
jgi:Gura_2753  246 tN--PSHEKLMSNW--D---DTfkyGFTTAKLSDY 273 Geobacter uraniireducens Rf4
jgi:Glov_3443  245 -----KDRAALV-M--G---QH---GFAPVLDANY 265 Geobacter lovleyi SZ
Q0A563         245 -GerPEDAELVTEW--GeplRH---GVETVSDEDY 273 Alkalilimnicola ehrlichii MLHE-1
CDK98150       239 -----ETAKSWGDN--I---RH---GAVAAFDGdy 260 Magnetospirillum gryphiswaldense MSR-1 v2
jgi:Desal_2373 272 dN--PEQAAILYQA--G---MR---GIIPAQDSDY 296 Desulfovibrio salexigens DSM 2638
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap