2HR2


Conserved Protein Domain Family
DUF3856

?
pfam12968: DUF3856 
Click on image for an interactive view with Cn3D
Domain of Unknown Function (DUF3856)
TPR-like protein. The 2hr2 structure belongs to the SCOP all alpha class, TPR-like superfamily, CT2138-like family. A DALI search gives hits with the putative peptidyl-prolyl isomerase 2fbn (Z=16), the SGTA protein (Z=16), the PLCR protein 2qfc (Z=16), a putative FK506-binding protein (Structure 1qz2-A; DALI Z-score 15.3; RMSD 2.9; 16% sequence identity within 132 superimposed residues), and with the tetratricopeptide repeats of the protein phosphatase 5 (Structure 2bug; DALI Z-score 15.1; RMSD 2.5; 19% sequence identity within 117 superimposed residues).
Statistics
?
PSSM-Id: 404005
View PSSM: pfam12968
Aligned: 6 rows
Threshold Bit Score: 226.219
Threshold Setting Gi: 116667795
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HR2_D             3 KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAXEISHTXPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADK 82  Chlorobacul...
jgi:Cpha266_2515   2 KPLREVAQAYMSLSDAGMQLQAGSYRDAAESCRKAMEMSRTISLEEAFDHEGFDAFCFATLSEAFWRLGRFEESLQSAEK 81  Chlorobium ...
WP_012504751       2 KPLKEVAMSYMALSEAQKKLEEGAYGEAAAESSKAMDFSKTMPPGETFDHEGFDALCYAVLASARAGLGEYDACLEAAGR 81  Prosthecoch...
jgi:Cphamn1_0159   2 KPLKQVAQAYMALSEGEKRLKEEAFEEAVAEYRKAMDVTRTIPEEEVFDHDGFDALCHAGLSGAFAKLGRYDECLLSADN 81  Chlorobium ...
WP_012506959       2 KPLIQVGHSYLALSQGEQQLRDAHFEEAAESYKRALEVSRTIPAEEAFDYNGFDALCHTGLSGAYVKLGRYEEALHSAEI 81  Pelodictyon...
Q3ANR7             2 KPLKQVGESYFLLSQGEKQIEGAAFEEAEQSYRLAMTMARTIPTEEAFDYDGFDAIAHAGLSSALIGLGRYNEALVSVAE 81  Chlorobium ...
2HR2_D            83 ALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAXPEFKKVVEXIEERKGETPGKER 144 Chlorobaculum tepidum TLS
jgi:Cpha266_2515  82 ALRYFNRRGELNQDEGKLWIAAVFSKAVALQETGSPEDAAGFFRTAGEMIAERKGELPGKEM 143 Chlorobium phaeobacteroides D...
WP_012504751      82 ALHYFNRRGELQQDEGKQWIAVVFSRGVAFHETGVYDEALKNLNMAGEMITERKGELPGKET 143 Prosthecochloris aestuarii
jgi:Cphamn1_0159  82 ALHYFNRRGELHQDEGKLWIAAVVNRAVGLAGTGRSSDALKAFRMADEMVAERKGEIDDKER 143 Chlorobium phaeobacteroides BS1
WP_012506959      82 GLRYFNRRGELHQDEGKQWIAAVFRRAQALEGIGRKEEALKAFQMAGEMIAERKGEMSDKEE 143 Pelodictyon phaeoclathratiforme
Q3ANR7            82 ALRYFNRRGDLHSAEGSLWIAVICNKARALESLGRKDEAIKYYRMAGEMIAEKKGEIKQRDL 143 Chlorobium chlorochromatii CaD3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap