Conserved Protein Domain Family
HeH

?
pfam12949: HeH 
HeH/LEM domain
This is a HeH domain. HeH domains form helix-extended loop-helix (HeH) structures. This domain is closely related to pfam03020 and pfam02037.
Statistics
?
PSSM-Id: 338564
View PSSM: pfam12949
Aligned: 39 rows
Threshold Bit Score: 47.7834
Threshold Setting Gi: 160364267
Created: 30-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6FSW1         12 PESLTVAKLRRVLTEHGVEYPANAKKAELAKLFKK 46   [Candida] glabrata
Q10109         11 LRNLRVIDLKKILHESGVSFPVNARKIEYIRMVDR 45   Schizosaccharomyces pombe 972h-
Q6FMP6         10 LSKLTAAQLRFVLAENKVSFPSKAKKADLLRLCNK 44   [Candida] glabrata
Q9A008         52 LDKLKSDEIKAKLDELGIEHDSKLKKAELLELLKa 86   Streptococcus pyogenes serotype M1
Q884L1         86 PLKMKVPELKEWLTAKGIEFDATAKKEDLQALVPK 120  Pseudomonas syringae pv. tomato
XP_002591693  843 VASLNVAKLRTELQKHGVEIPSKSKKADLVRLLTD 877  Florida lancelet
XP_002607488  531 VASRTVHKLRVELRKHGVDIPSRAKKDDLVRMLTD 565  Florida lancelet
XP_002172988   10 LATLRVIDLKRILSSYGISLPHNAKKVDFVNLVQQ 44   Schizosaccharomyces japonicus yFS275
XP_001749129 1504 VKKMKVAELKEALQARQIAFDSKDRKAELQEHLLK 1538 Monosiga brevicollis MX1
WP_043781707   50 AKKATVAELRAALEAKGVEVPEGAKKADLQALLDA 84   Delftia acidovorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap