3E0Z


Conserved Protein Domain Family
DUF3837

?
pfam12939: DUF3837 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3837)
A small, compact all-alpha helical domain of unknown function. This domain is currently only found in Clostridiales species.
Statistics
?
PSSM-Id: 315594
View PSSM: pfam12939
Aligned: 15 rows
Threshold Bit Score: 88.8605
Threshold Setting Gi: 524129790
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3E0Z_A         3 ITSIARQSIILKCLRQK--SVLVSNYELYYTAGLAKKCFGI-AVDADXEPKQLLEELQKHIDKVSPADEQEKYLIHLLGN 79
gi 547181838   2 VTSIARQSVILKCNMQK--AVMLGNYEFYYGAGVAGKIGGF-EIPDDIKPLELRELLDKNLDQISPKDEKETYLIHILKE 78
gi 524041089   2 VPDLARMSVIIKSQHET--SVMTGNYEMGYACGLLCKLAGR-EVPQWETPVELKDRVAELLTGYEPANEREKNVIHMLHY 78
gi 493909926   2 VTSIARQSVIIKCNMQK--SVLTGNYEFYYAAGLIAKLSGV-EISDDIKPIELGVLLHQEIEKTEPKDEQEKYLFSMLKD 78
gi 524838945   2 VTSIARQSIVIKCKLKK--SILLGNYEFYYAAGLIGKLTGQ-TFDFDVSPEEMSAAAQEALKNYTPKDDREEYLAHIFSN 78
gi 523997430   2 VTLLAKNAVQIKCGFEN--AIMTGNYECAYALGVLCAISGQqQYENYGNIIELKKKVFDNMGQFSSDDKKIKRMVEMLEG 79
gi 524735391   2 VPVLAKNAVRIKCNFQN--AGMTGNYECAYALGILNAQLGLpEITEYEDIAALKEQLLEKAADYKTEEAGLKQMVHLLKE 79
gi 502240184   2 VPILAKQALARKCEFSN--ARMTGNYECAYALGVVSGALAIpKEENAANLVELKNKIEPQYKKLSSENEQIKKLILLLCD 79
gi 524063626   1 mSYIIKMALDIKARFNPp-AHMSSPIEAYCAIGTVAKALGLpCPQRKDTLFEMRQELSDAEAGKSFPSERIEKINQILMS 79
gi 524741250   2 IIDLVEDAVEIKIHFEKftGILQSNYEFAYALGRMQKMMGQpLIEE-NSLTSWKDAVEKQLKDYEPKDYLEENLKKLILE 80
                         90
                 ....*....|....
3E0Z_A        80 YEPDDTHDEQTVEL 93
gi 547181838  79 FRPDELYDEQMKEL 92
gi 524041089  79 YHPDETADEQVKEL 92
gi 493909926  79 YKPTDEYDEQMKEL 92
gi 524838945  79 YKPDEEKNEQMKEL 92
gi 523997430  80 YEPSEQMDNQMEEL 93
gi 524735391  80 YEAAPVADEQMREL 93
gi 502240184  80 YEPSDIFDEQMREL 93
gi 524063626  80 FIRDEETTDAMMAY 93
gi 524741250  81 YRMQEQDGEEIQQL 94
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap