3E0Z


Conserved Protein Domain Family
DUF3837

?
pfam12939: DUF3837 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3837)
A small, compact all-alpha helical domain of unknown function. This domain is currently only found in Clostridiales species.
Statistics
?
PSSM-Id: 315594
View PSSM: pfam12939
Aligned: 15 rows
Threshold Bit Score: 88.8605
Threshold Setting Gi: 524129790
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E0Z_A         3 ITSIARQSIILKCLRQK--SVLVSNYELYYTAGLAKKCFGI-AVDADXEPKQLLEELQKHIDKVSPADEQEKYLIHLLGN 79  Eubacterium rec...
WP_021924054   2 VTSIARQSVILKCNMQK--AVMLGNYEFYYGAGVAGKIGGF-EIPDDIKPLELRELLDKNLDQISPKDEKETYLIHILKE 78  Roseburia inuli...
CCY22764       2 VPDLARMSVIIKSQHET--SVMTGNYEMGYACGLLCKLAGR-EVPQWETPVELKDRVAELLTGYEPANEREKNVIHMLHY 78  Firmicutes bact...
WP_006855449   2 VTSIARQSVIIKCNMQK--SVLTGNYEFYYAAGLIAKLSGV-EISDDIKPIELGVLLHQEIEKTEPKDEQEKYLFSMLKD 78  Roseburia intes...
CDF43876       2 VTSIARQSIVIKCKLKK--SILLGNYEFYYAAGLIGKLTGQ-TFDFDVSPEEMSAAAQEALKNYTPKDDREEYLAHIFSN 78  Roseburia sp. C...
CCX84032       2 VTLLAKNAVQIKCGFEN--AIMTGNYECAYALGVLCAISGQqQYENYGNIIELKKKVFDNMGQFSSDDKKIKRMVEMLEG 79  Eubacterium sp....
CDE35337       2 VPVLAKNAVRIKCNFQN--AGMTGNYECAYALGILNAQLGLpEITEYEDIAALKEQLLEKAADYKTEEAGLKQMVHLLKE 79  Eubacterium sp....
WP_012739532   2 VPILAKQALARKCEFSN--ARMTGNYECAYALGVVSGALAIpKEENAANLVELKNKIEPQYKKLSSENEQIKKLILLLCD 79  Eubacterium eli...
CCY41159       1 mSYIIKMALDIKARFNPp-AHMSSPIEAYCAIGTVAKALGLpCPQRKDTLFEMRQELSDAEAGKSFPSERIEKINQILMS 79  Clostridium sp....
CDE46097       2 IIDLVEDAVEIKIHFEKftGILQSNYEFAYALGRMQKMMGQpLIEE-NSLTSWKDAVEKQLKDYEPKDYLEENLKKLILE 80  Clostridium sp....
3E0Z_A        80 YEPDDTHDEQTVEL 93  Eubacterium rectale
WP_021924054  79 FRPDELYDEQMKEL 92  Roseburia inulinivorans
CCY22764      79 YHPDETADEQVKEL 92  Firmicutes bacterium CAG:24
WP_006855449  79 YKPTDEYDEQMKEL 92  Roseburia intestinalis
CDF43876      79 YKPDEEKNEQMKEL 92  Roseburia sp. CAG:182
CCX84032      80 YEPSEQMDNQMEEL 93  Eubacterium sp. CAG:86
CDE35337      80 YEAAPVADEQMREL 93  Eubacterium sp. CAG:38
WP_012739532  80 YEPSDIFDEQMREL 93  Eubacterium eligens
CCY41159      80 FIRDEETTDAMMAY 93  Clostridium sp. CAG:7
CDE46097      81 YRMQEQDGEEIQQL 94  Clostridium sp. CAG:411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap