Conserved Protein Domain Family
Cnd1_N

?
pfam12922: Cnd1_N 
non-SMC mitotic condensation complex subunit 1, N-term
The three non-SMC (structural maintenance of chromosomes) subunits of the mitotic condensation complex are Cnd1-3. The whole complex is essential for viability and the condensing of chromosomes in mitosis. This is the conserved N-terminus of the subunit 1.
Statistics
?
PSSM-Id: 338552
View PSSM: pfam12922
Aligned: 144 rows
Threshold Bit Score: 86.4663
Threshold Setting Gi: 159489006
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5K972         78 SGILTKLLDVIVSGLSYHSSTV-MAI-V-----N----GQgfga--eadmDAP----M---V-----HKQPLEMWAFLLQ 132  Cryptococcus ...
Q01DX9         83 AIERARLMDAMCSNLSVLCASAsARE-R-----Ee--rQEg--------dEEI----S---W-----TRAALKAYVGFIF 134  Ostreococcus ...
XP_001416340   13 PIERMRLIDALCSNLSVLSASV-TAA-V-----Vs---GAs--------aDEA----H---AetmfgYRQALKAYATFIF 67   Ostreococcus ...
XP_001783088   82 PSARGSLVESLCSNLAVLITSI-TAQ-S-----Ha---SSestedaaymlQQM----H---L-----HRNALKIYSYFLQ 139  Physcomitrell...
XP_004361359   77 kDIRNIVLKIIQGGLQGLSIAI-QKV-IsitpqQq---TDd--------hDRYnnqlL---Q-----VRSALKIYVYFLH 135  Dictyostelium...
XP_002965540   77 PSTKRLIIESLCSNFTLLIASI-ASLkR-----Ed---AEsdpa---llcQQI----H---S-----QQNALKLYSFFLQ 132  Selaginella m...
XP_005849153   79 gpkRRQLIDSLCSSLTCLNAWI-DKL-L-----AapadSHd--------pDSV----R---Q-----HRSAFKAYIFFLG 131  Chlorella var...
XP_002502428   80 avARIRLCDALCSNLSVLSSAA-HTM-L-----Aa---GAg--------aDGA----DavaS-----HREALKCYSTLIY 132  Micromonas sp...
XP_002895348   77 eSLRMRVVEMLAAFVSNVTEGV-LAR-R-----Pg---SEd--------aDDV----V---L-----YRSAFKASVYFLI 126  Phytophthora ...
XP_001702488   80 vAMCKNLHTVATSGLQELGE----HQ-F-----Ek---GNp----------AV----V---E-----HLSAVHAYTYFLA 124  Chlamydomonas...
Q5K972        133 WF--VNA-------AERGAGKTNDEprq-------amT---G--RGKKkttktaGG--AG-----ISTSFvfSDHLPLVL 184  Cryptococcus ...
Q01DX9        135 HV--CER-------CEKESTSFDGVaav-------aaA---G--KGKKa-----KT--KS-----QLVEWrwDEQRERVV 181  Ostreococcus ...
XP_001416340   68 HV--CEV-------CEKESKECAAMac--------aqKpapG--AKGKk-----KQtnKA-----KLAEWawDEQRERIV 118  Ostreococcus ...
XP_001783088  140 CV--LIM-------EEAAEVK----------------P---G--KKVHp-----RK--EP-----VPAKWswDVPRTRIV 177  Physcomitrell...
XP_004361359  136 IL--VKTqlersppEAADGAQSSSQtp--------akQ---GakRKKKg-----SS--AA-----EEELWdsDQNRERLI 190  Dictyostelium...
XP_002965540  133 QI--YTL-------EEAPCS--DSQkt--------kaS---T--KSKQp-----RK--KN-----PTLSWkwEDFRARIV 176  Selaginella m...
XP_005849153  132 WIsgLAA-------QESRKAAAEGSgssatqavggagR---G--RKKKa-----AA--SE------VAGWdwGTQFPRVV 186  Chlorella var...
XP_002502428  133 HL--AKG-------AEADAANAGAAppae----dpktK---G--KKGSk-----SK--AA-----PLAEWkwDEQRERVL 182  Micromonas sp...
XP_002895348  127 TA--LTS-------VSSLQVQAEKDii--------khK---G--KGK-------SQ--NL-----TINRVnwSKVMEGAI 170  Phytophthora ...
XP_001702488  125 VI--MQH-------SQASLAEAMKAdaqqk--gaapkK---G--RGKTk-----AP--AEdgeggAAELWw-D-IMGRIA 179  Chlamydomonas...
Q5K972        185 GTMHKTLRIPTSR-LWRTSSEREAFISCFVKPAYQLAETEAYLKISEIRLGIFKVICLAVKFHQHAFGA 252  Cryptococcus neoformans
Q01DX9        182 HVMAGVLDVDLWQ-VFRPKQPEEEFLLLFVRLGSMCLENSAAMKSKVTKRATFEMMGSCALKWGQLEQV 249  Ostreococcus tauri
XP_001416340  119 HVMAGALDIDLWQ-VFRPKQPEEDFLRLFVRLGSMLLENPAALKSKVTKRAAFEMMGSCALKWGQLEQV 186  Ostreococcus lucimarinus...
XP_001783088  178 RLLATTVEIDLRH-LYSMSQPENDFIALFAEAAFLLLENSAYTKEKDLKDALCNILAACAAKYGYivpv 245  Physcomitrella patens
XP_004361359  191 QYLYEAFEKDLTR-LWPMTRPDEEMLSLVQRVLFSMLEKQENIKTASIRISIYSFIVLLVKNYEFHMTT 258  Dictyostelium fasciculatum
XP_002965540  177 SSVTRVLEADLQL-LYGMARPENGLLNFLAKFGLKLLENPTVMKDKEAKDEVCKFLATCAVKYDYHEQl 244  Selaginella moellendorffii
XP_005849153  187 KAVAQALNTDLWA-LFRPSGPEEPLLMKALQLASSALEDPGCLKCEEQAANAAHILAVMALKYQQLDNV 254  Chlorella variabilis
XP_002502428  183 HVMSGVLDVDLWN-LFRPRQPPEAFLTMFTSLACAAMESQTALRSKVTKAAAFDMLGACALKWGQLENV 250  Micromonas sp. RCC299
XP_002895348  171 HKLSRSVSPKTFA-MWNMNVPEEEFSMLYCKVVFELLGNATLCRGKSLKPKLFHLLAMSLQKapaihis 238  Phytophthora infestans T...
XP_001702488  180 RVLVSVLRADLDGvLYRVPAEKSSLLNLVVQAVGRCLGEVGVLKQT-------KLLGWCNDVLLHTATT 241  Chlamydomonas reinhardtii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap