2PAR


Conserved Protein Domain Family
HD_2

?
pfam12917: HD_2 
Click on image for an interactive view with Cn3D
HD containing hydrolase-like enzyme
This is a family of bacterial and archaeal hydrolases.
Statistics
?
Aligned: 108 rows
Threshold Bit Score: 152.647
Threshold Setting Gi: 818476467
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PAR_A                 7 HFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKfgG--NVNAERIALLAMYHDASAVLTGDLPTPV 84  Escheri...
WP_068456413           5 KFFTSLNDLERIIRAPGRFKFEEHNVAAHSWKVSQYAMFFATLEEMH--Ga-TIDWKSLYEKTINHDYGEIFIGDIKTPV 81  Kurthia
EST11956               5 KYFQSLSDLEGIYRCPGVFKYQEHSVASHSFKVATIVQFLATVEDQH--Gq-KVDWKTVYEKAINHDYSELFTGDIKTPV 81  Sporola...
EUJ40013               5 HFFGSLADLELIVRCPGKFKYQPHNVAAHSFKVAQIAQFLGLVEEQA--Qq-AINWRSLYEKALNHDYSELFIGDIKTPV 81  Brochot...
KRN75750               5 QYLSGLTELEMINRAPGYFKYFPHSVAAHSWKVTQVAQFLGDVEEKQ--Ge-AVNWKLLYEKALNHDINERFIGDIRTPV 81  Weissel...
EFH30241               5 AYLQGLSSLESIDRAPGYFKYQHHSVAAHCFRTAEFAQMMGDIEEVY--GdqEVNWKALYEKSLNHDYTERFIGDIKTPV 82  Lactoba...
5456:JMA_42720         5 TYFKSLSKLERMYRCPGEFLFEQHNVASHSFKVAQYCQFLAEVEAKN--Gv-EIDWKSLYEKALNHDYPEIFIGDIKTPV 81  Jeotgal...
goetting:Curi_c17990   5 NYLKIVRKLNNMGRWSNEYMHMRATVSEHLFFVTQIGQMLAVIEEEN--Gn-TIDWKKLLTKLINHDVPEAMTGDIINTM 81  Gottsch...
ERI92597               5 KYLRTVRKLNNMGRWAPEFMHQRATVSEHSFQVAQIGQMLALIEEEH--Gn-KVDWEKLFKKLINHDVVEALTGDILSFV 81  Clostri...
KGP76542               9 NYLLAVRKLNNMGRWATEFMHSRTTVSEHSFFVAQVGQMLGLIEEEH--Sn-VVDWGRLFKKLLNHDVVEAITGDIISTV 85  Desulfo...
2PAR_A                85 KYFNSQIAQEYKAIEKI-AQQKLVDMVPEELRDIFAPLId---EHAYsdeEKSLVKQADALCAYLKCLEELAAGNNE--F 158 Escheri...
WP_068456413          82 KHSSPELKNMIALVEEKmVEHYIEEEIPKEFQATFKHRMkegkDETI---EGRLLELSDKLDQFYESFAELKRGNKDieF 158 Kurthia
EST11956              82 KYALPKLRELFSQVEGSmTQEYLDKEFPQEFRQVYEARFkegkDRSL---EGKILAVADKIDLLYEAYGEIQKGNPEplF 158 Sporola...
EUJ40013              82 KYASVELREMLSDVEETmTTNFIEKEVPERFQADFQRFFkegkDESL---EGQLLAVADKVDLLYESYAEIQQGNSEplF 158 Brochot...
KRN75750              82 KYASSELRHMLADVEESlADNFIRMEIPSNYRDAYHRRLsegkDDTL---EGRILSVADKVDLLYEAFGELQKGNPEpvF 158 Weissel...
EFH30241              83 KYATPQMRKLVGDVEEAmTNEFIKHEIPAEFQEIYRNRLseakDDTL---EGKILSVCDKLDLMYEAYGEIELGNPNpvY 159 Lactoba...
5456:JMA_42720        82 KYSSPEMREMIAQVEEGmAKKFVEEELPVEFQEIYHEKLkegkDGSI---EGMILAVADKLDQVYESFEEIQRGNTDmvF 158 Jeotgal...
goetting:Curi_c17990  82 KYRDSKLKALVDKIEDElVEEVLIEELENPYKEKYREILtnfkDDTI---EGQILSYADSIDALLECIYEIQLGNTQt-F 157 Gottsch...
ERI92597              82 KHRKQEMKNMVDIIEEEvADEYLLSYMEEPYRSIYKKLMfdgkDKTL---EGQILKCADHIDALIECINEINLENCNp-F 157 Clostri...
KGP76542              86 KHKSKEMRDMVCLIEKEaAEESLFAHMEGPYKITYREILfegkDDTL---EGRILQAADYIDALMECIGEIRLHNNFp-F 161 Desulfo...
2PAR_A               159 LLAKTRLEATLEARR-SQEMDYFMEIFVPSF 188 Escherichia coli K-12
WP_068456413         159 VKMYQIALKKILNLPlPNSVDYFKNTMLKDV 189 Kurthia
EST11956             159 FQIYKEALTSIVQFNdLASVRYFIKVILKEM 189 Sporolactobacillus laevolacticus DSM 442
EUJ40013             159 YDIYAEALETILRYRhLASVTYFIDEILPDV 189 Brochothrix campestris FSL F6-1037
KRN75750             159 LDIYKESLETIYAFRdMNSTKYFINEVLPEM 189 Weissella kandleri
EFH30241             160 MQMFKESLETIKEFDdLACVKYFIKKILPDL 190 Lactobacillus jensenii JV-V16
5456:JMA_42720       159 VQIYQNALKIIKSId-LHCVRYFLDNVLPEM 188 Jeotgalibacillus malaysiensis
goetting:Curi_c17990 158 NEKYSMLVNKLKESN-LISVKYFIDEILPSI 187 Gottschalkia acidurici 9a
ERI92597             158 EDKYNTILNQLKQID-LISARFFLDSILPNL 187 Clostridiales bacterium oral taxon 876 str. F0540
KGP76542             162 VEKYHGILEKLKEVD-LISVRYFVEFILPPL 191 Desulfosporosinus sp. Tol-M
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap