Conserved Protein Domain Family
DUF3829

?
pfam12889: DUF3829 
Protein of unknown function (DUF3829)
This is a small family of proteins from several bacterial species, whose function is not known. It may, however, be related to the GvpL_GvpF family of proteins, pfam06386.
Statistics
?
PSSM-Id: 338536
View PSSM: pfam12889
Aligned: 27 rows
Threshold Bit Score: 137.166
Threshold Setting Gi: 490832960
Created: 10-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q892X6        30 EKYNEKYEAYATLDTFITGKLQESLDYYFVKFGYTEEFEANKNDY---------LYNgillefnK-NELEKVFSYY-SAK 98  Clostridium tetani
Q892X5        34 KEDIEKYNNYIALSNYMTGLMDDALGIYVEKFGIGDEIVIKEGFNg--------FNGvpilethK-DQLDKVLEYA-SKK 103 Clostridium tetani
CDH90708     152 vtkEEKYQEYVKLNNNILWRFDASVTPYVEQFGNGDEIIIPSNGIsgit--pviDSF-------F-NELDILKDEA-IQK 220 Clostridium bot...
CDH90676     214 YQYEKKYQCYVKFNNDIVDCYNYSIDLYFKSKGNSETVKHKYNPNqvdm--apiLKQ-------KyEVLEKVRKAA-NSD 283 Clostridium bot...
AGF57652     206 AEYDKKYQCYVEFNNDIVDCYNQSIDLYFKSKGNSEILKHKYNPNkvdm--gpiLKQ-------KyDNIEKVKKAA-NSN 275 Clostridium sac...
WP_015769830  37 NEEMEKYNSYIEIYNKL-SIIDDEISSYIEAAGENNSINIEQMKTlgni--pviKIE-------S-QIFEKLEKNI-NSK 104 Leptotrichia bu...
WP_012806490  40 EKNKEKYNKHIRFYNRI-LNIDKGLLYYFEDAGMEKKFKVIQDEDikad----iaiD-------R-NFIDKLKELE-QNE 105 Leptotrichia bu...
WP_038505719  59 TEFVVKYNNYIEFFNTYDDKVRKSYANYLSWVNQKETSGTTNLKSkig---------------lplEELNILKSTI-VHS 122 Cellulophaga ly...
WP_007693526  44 laNSAKLNDYVLAYNDLIGD-----SGLLAQYQAYENANISKSTTsdnitdvskGSL-------E-QSADKLKTVRgAKS 110 Rhizobium/Agrob...
WP_013369402  39 SKEIEKYNAYVRLNNLMTGRINEVLVHYFEKFGGDTQPVIEKNFS---------FIMlgvaeteR-EIVDKANGYT-ASQ 107 Paenibacillus p...
Q892X6        99 PNFDKVDNSLKNLHAEFKELIQSLSDAD-TYYKLKSYVDDDFVKGKELHKKICSQYTKVKPLKKDFSTHFGDFFIEDSKE 177 Clostridium tetani
Q892X5       104 PSYGETDDAMKALHPKMKELMNTLGEIE-NYYNAKSFVDDKFNKGKELHKKVCSQYKEYSDLAVKFFISFDNITEQKKKE 182 Clostridium tetani
CDH90708     221 PK-TDTDESAITLIDETRNMYNIINEVY-AYYNEEEYKNDNLSRAQEIHDTYMNEIEMWYYRYMQFSEKLNPMAIEIMGK 298 Clostridium bot...
CDH90676     284 PKM-EIDEDIIKLADATEKVYNLIGEIYcAYGGEEQYGKKTDKTKEELHKELYTYVNEYDGIYINFSNRFESMSIEHMSK 362 Clostridium bot...
AGF57652     276 PKI-EIDEYVIKLADATQKVYDLISEIYyAYGGNEEYGKKNDKTKEQLHKEFYNYVKEYDEIYSNFNKKFDKVSIEHMQS 354 Clostridium sac...
WP_015769830 105 FKMEKLDNSAKKLLPILKELKTATDTMG-NYYGKKENLTDNFAKSQGLHTSFLRIYKKYKISSDLFKMEMAKVSDEKMQK 183 Leptotrichia bu...
WP_012806490 106 DKKSELDKKAITMIPILEKMLPIADEMR-TYYKNKEYLKDKYAKAQTLHTELLAILDKYNQVTKAYKDLFEKKSDEIKKL 184 Leptotrichia bu...
WP_038505719 123 PAIKKVDANMLLVYKTAEILYNTILEVD-AYYKKGIVESVDVNKTKKLHIKLLEAYRNYFSTFDDMSIVFYRLQDDVEKY 201 Cellulophaga ly...
WP_007693526 111 DAPTELDTAADKLISALGQVVPRLSGLD-VYYASKAYMEDGLARGKREDPLMLTDFQAAAVALEEFHQQLQKELDRREQA 189 Rhizobium/Agrob...
WP_013369402 108 PAFANVDPVVIKLTPVINDLLSVLDEMK-AYYDTKGYVDDDFAKGKQLHTKLVSANLAYETVAKQYFTALQKLGNEQRLA 186 Paenibacillus p...
Q892X6       178 KLEEFKKNDFMIKYYALSSLLKAKDLEIELQRQKVAKGNM---EsLDIRKFKEKYNLLVADMNKFLEYSKDSNRIk---- 250 Clostridium tetani
Q892X5       183 DLDKLKENDMMIRYYAMSILNRAQDIEMSFYRAKITDDNI---LdYDANKYKEKYDLLTEDINKFIEYSKDNKRAk---- 255 Clostridium tetani
CDH90708     299 NLDTYKKNGQDFEYYTLKLLIDGEAIINYMSDNKIDDTNI---LssDITKYKTLLDTLNKTYEQYKVYSKD-KNG----- 369 Clostridium bot...
CDH90676     363 GLKKYKENGDMDSYHTLNILIKSEEIYKYFINNNITNKNL---FnmNLEEYKKLLDDYNKAYSEFQKQDI--KGG----- 432 Clostridium bot...
AGF57652     355 ELKKYEDSEDMDSYHTLNMLIKSEELYRYFIDNNITNKNL---FsmNLDEYKKLLDDYNKAYLDFQKQDIKGG------- 424 Clostridium sac...
WP_015769830 184 VLETYKNEGSIIKYNLTILMNNCESFIDKIDNPKLRMTTFi-kG--DLGKLKKIQQNISISSNSFQKVIENEKQL----- 255 Leptotrichia bu...
WP_012806490 185 MIKDYDKRREFITYNQFMFIEEGNNIIKEIHKQGLDASDFttkG--NPKKFKKIEEKMIKALVKFEKSLKNEKQL----- 257 Leptotrichia bu...
WP_038505719 202 KKEKYKEQELVVQYNLFTAINATEAILNEIGGRDVDGLLT---L--DFTVINQKIKELRAAYVALEGLKENQDLIvkefg 276 Cellulophaga ly...
WP_007693526 190 ELAKIKERGDMPVYQTRLALSQARQLVDLLNSSEEPGKPA---L---QSQIDAKITDLEKTLEDQRTAMAKAKQEggs-g 262 Rhizobium/Agrob...
WP_013369402 187 ELQKLKDSDQQIRYNALKFMIDAEATAIEMDEQGITADNV---LqLDMTKFKAKYDIMTADLSTLMTISKDKKRVq---- 259 Paenibacillus p...
Q892X6       251 -kE------NIDQAFPYAIMDVKSSATDILTKVEGK-------DSYRNFG-----YSKNQEGTTEYFSNKIKEAILQYVK 311 Clostridium tetani
Q892X5       256 -kEq----iAILPTFSSDIKRAKVAATDIMEILKTK-------NTNINANtkgriTKAGKTAPLYEFSRIVSNMVDSYNN 323 Clostridium tetani
CDH90708     370 --S------IHLEALQKNLSCFIESANRIVEVVEKQdls-agiVYTPGIV-----YAESEPSPVEDLSYYLDRMISEYNS 435 Clostridium bot...
CDH90676     433 --T------CHTETFGEFVQAYHGFSNNIVNMVNNKtfdagklDAAPGLV-----APDDNKDIKERLYFYIDRMISDYNS 499 Clostridium bot...
AGF57652     425 --T------THTSGFKEFVQAYHSFVNNIVNMVNNKtfdsgelDAKPGLV-----GPDDDEDIQARLYFYIDRMVSEYNS 491 Clostridium sac...
WP_015769830 256 --KkenysrEKLEIFNKQLAQFEKSVTIFIRELEKNkll-ninQIEK-KI-----YSENSAGTPNDVIKNYNKLVNDYNN 326 Leptotrichia bu...
WP_012806490 258 --KkegytvGEHNDFIQKANKFKQSVNVFIQKIEKKeka-shsSAS-DSF-----FAQTEEGTPENILSNFNEVIKEHNK 328 Leptotrichia bu...
WP_038505719 277 kpM------PVVTNFTNHLGNILMGLTSLKLRIANNdfd-ygkDH----------PNIAADGSPLKLELEFIAMVNEYRS 339 Cellulophaga ly...
WP_007693526 263 vnT------PLLDGINDSLTGMVGDFREIKQ--------------------------DPTPDKYQLVVTRFNSAIEMFNS 310 Rhizobium/Agrob...
WP_013369402 260 -kEgi--nsFSIESYVDSATEAKAAASKIIERINKK-------EPVSDSDln-gqFLNTTDGTPENFNYKLSKAVERYNE 328 Paenibacillus p...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap