4M59


Conserved Protein Domain Family
PPR_1

?
pfam12854: PPR_1 
Click on image for an interactive view with Cn3D
PPR repeat
This family matches additional variants of the PPR repeat that were not captured by the model for pfam01535. The exact function is not known.
Statistics
?
PSSM-Id: 315520
View PSSM: pfam12854
Aligned: 201 rows
Threshold Bit Score: 39.6272
Threshold Setting Gi: 75163930
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                            10        20        30
                    ....*....|....*....|....*....|....
4M59_B          593 QTMKPDVVSYNTVINGFCKQGLVKEAQRVLSEMV 626
15_pfamImport     1 TGHDVDYFICNVLISSLCRAGRVAEAEDFMRHMS 34
gi 223635748    502 EGHTRDHFTFNVLVTSLCKAGKVAEAEEFMRCMT 535
9_pfamImport      1 PRMKTDAVAWNVLLDSYCRNGRVADAKRMFLQMK 34
75_pfamImport     1 QCMMYDFRVLNTLLFAYCRKGLLKKAEAAVEKAA 34
122_pfamImport    1 NGLFPDRNTFNILVSGYCKLGWLKEAAQVIDVMA 34
gi 75174107     289 DGFFPDQYTFNTLVNGLCKAGHVKHAIEIMDVML 322
119_pfamImport    1 SGFSPDCVTFNTLSNGYCKAGRLSEAFRMMDEMS 34
45_pfamImport     1 LGLQPTLVTFNTLLSGLCSKAKIMDAVKLFDEMV 34
gi 75167758     171 MGHKPTLITLNALVNGLCLNGKVSDAVLLIDRMV 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap