6QE6


Conserved Protein Domain Family
Methyltransf_18

?
pfam12847: Methyltransf_18 
Click on image for an interactive view with Cn3D
Methyltransferase domain
Protein in this family function as methyltransferases.
Statistics
?
Aligned: 220 rows
Threshold Bit Score: 113.674
Threshold Setting Gi: 119864111
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6QE6_A             22 L-SFRLNQVAKLINNST-AIADIGTDHAYLPIYLVQNNKTKIAYACDINQKPLNIALKNVEK--FGLTGQIFTILSNGLE 97  Mycoplasma...
IGS:MHF_0129        1 M-HARILGLASIFP-YSkNLVDIGSDHGYLGLELIRQRKVGKVTNIDLSEDALNRSKIIYEK--LGFLDRSTFLVSDGFK 76  Mycoplasma...
BAG08240            1 MkKLRLEEIIKLVEENS-IVADIGTDHGIVPYELVKSAKAKKVIASDISEKSLDKLREKLDYl-DEPEKIVLN-VSDGLD 77  Finegoldia...
VBC:X271_00331      1 MfKGRIIEIADYISKNS-QVLDIGTDHGYIPLYLLKNKITDKITATDINTKPLLQAKKTLID--YKDLETLKFIKSNGFE 77  Candidatus...
CAM11946            1 --MKRINFIASLTK-NYnTVLDIGTDHGFVLKKAFHEGYIKKAIASDLRIKPLLQSQKTLQN--Y----PVTFCLSDGFQ 71  Candidatus...
ripcm:ACL_0943      1 --MNRIAFIGELTK-GYeTVIDIGSDHGLVLKYALDHKYIKHAVASDINKGPLNHAKKNLAG--Y----PVRFYLSDGFK 71  Acholeplas...
UNSW:PCNPT3_06330   3 L-SKRLQSIFEQVKQPYtHIWDCCCDHGQLGFKLLGKDKAQHVHFVDINQNLMQKLEKKLQRyyQGSVSDWQVHCLDVSQ 81  Psychromon...
BAK56315            3 S-SNRIRHIINMCKYNE-TIIDVGCDHGYISIGLLNSNKCSRCYAVDINKDPINIAMNNIKK--YNLDTKIRCILSDGFN 78  Candidatus...
CDE25397            1 --MDRIELIASLAKDAN-SLVDCGCDHGYTAIKALKSYNVSHCYLLDINEGPLNNARNNVAK--ENLsDKCDFILSDGLK 75  Clostridiu...
CDD91265            4 L-SLRLETLLSMIPTNVhYLVDVGADHGYFILEAIARKRVESGMAVENKKGPYTHLVEMVKK--YHFENQVETSFSSGLE 80  Coprobacil...
6QE6_A             98 FVK-NK--EilnID---YVTICGLGSQTILEILKND--HQKISN-----YIICSNTSVKNLRLWAVSHNYLIKYESFIYE 164 Mycoplasma...
IGS:MHF_0129       77 ELKlVP------IDs--TVVIAGMGTYQILKILEFL-------PdtvdkLLILSHTDYFFLRNWAVLNSFSILREFYIDD 141 Mycoplasma...
BAG08240           78 NLN-EY--Q---VD---TIIISGMGGNLIVDILNKN--LDIAKSan--cLILGANNSLALLRRFLHENSFEIIEEVDLFE 144 Finegoldia...
VBC:X271_00331     78 NIIdIAsyQ--------YIIIAGLGGKTIEIILKNY--NDNAI------LILNPTNNEAILRKFLYDNKFKIEDEKLIYE 141 Candidatus...
CAM11946           72 KIN-----Qd--FD---LALICGMGTYTIIKIMEQA-------PdkskhFLLGTQSKYQLLKQWLEQNNYLILEEHHLF- 133 Candidatus...
ripcm:ACL_0943     72 SVD-----Kd--YN---LAVITGMGPHLIIDILKEVmhLEDKT------YILGANEKIEVLRTWLSNNGFNIVDEYVIF- 134 Acholeplas...
UNSW:PCNPT3_06330  82 LPLkNHqqSs--LKethLIIIAGVGGQLLSTFLEALlpLNAQFNi---eFLICPVHHNFLVRETLIKHKLKLINELLIFE 156 Psychromon...
BAK56315           79 WF--DS--Le--NT---SAVIAGMGGSTIASIINRN--INKIKYmn--yILIQPNAYSKDIRKYLYDKQFHVEKEDVIYS 145 Candidatus...
CDE25397           76 NFN-----Ee--AD---VLVIAGMGGLLISNIILND--YEKVIKfk--kIIIDAHSEIEKLRANLISKYFVFDNEILIQD 141 Clostridiu...
CDD91265           81 KVK-----Vp--LD---LALIAGMGTPTILSILHHD--IEKLKDih--yLLIDAHNQLPELRKEVTRLGYKIIGEEIVEE 146 Coprobacil...
6QE6_A            165 DDHYYWLI 172 Mycoplasma capricolum subsp. capricolum
IGS:MHF_0129      142 KDLVYLAI 149 Mycoplasma haemofelis Ohio2
BAG08240          145 NDKYYQII 152 Finegoldia magna ATCC 29328
VBC:X271_00331    142 NNIYSIII 149 Candidatus Hepatoplasma crinochetorum Av
CAM11946          134 DKFLYSFL 141 Candidatus Phytoplasma australiense
ripcm:ACL_0943    135 DGFYYVFL 142 Acholeplasma laidlawii PG-8A
UNSW:PCNPT3_06330 157 QGRYYEIL 164 Psychromonas sp. CNPT3
BAK56315          146 KGIYYEYI 153 Candidatus Arthromitus sp. SFB-mouse-Japan
CDE25397          142 GKHNYVII 149 Clostridium sp. CAG:307
CDD91265          147 EQVFYELV 154 Coprobacillus sp. CAG:826
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap