Conserved Protein Domain Family
Methyltransf_18

?
pfam12847: Methyltransf_18 
Methyltransferase domain
Protein in this family function as methyltransferases.
Statistics
?
PSSM-Id: 338519
View PSSM: pfam12847
Aligned: 222 rows
Threshold Bit Score: 113.293
Threshold Setting Gi: 500094141
Created: 31-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0AZ82         2 L-NKRLLTVSDSVIRGE-AAADIGADHGLLALFLLEKGIVPWVIASEVKEGPFERLRQAVEK--STFYERIELRLGNGLE 77  Syntrophomonas ...
WP_069569487   1 --MNRIAFIGELTK-GYeTVIDIGSDHGLVLKYALDHKYIKHAVASDINKGPLNHAKKNLAG--Y----PVRFYLSDGFK 71  Acholeplasma la...
WP_012359084   1 --MKRINFIASLTK-NYnTVLDIGTDHGFVLKKAFHEGYIKKAIASDLRIKPLLQSQKTLQN--Y----PVTFCLSDGFQ 71  Candidatus Phyt...
AHK22437       1 MfKGRIIEIADYISKNS-QVLDIGTDHGYIPLYLLKNKITDKITATDINTKPLLQAKKTLID--YKDLETLKFIKSNGFE 77  Candidatus Hepa...
WP_015778063   2 EdKKRLLDIISLIDKNK-KVIDIGTDHGLVPLYLAKNGISKEILATDISEKSLDKLRGVLD---SDTEKFIQTMVTDGFK 77  Anaerococcus pr...
WP_002839046   1 MkKLRLEEIIKLVEENS-IVADIGTDHGIVPYELVKSAKAKKVIASDISEKSLDKLREKLDYl-DEPEKIVLN-VSDGLD 77  Finegoldia magna
CDE25397       1 --MDRIELIASLAKDAN-SLVDCGCDHGYTAIKALKSYNVSHCYLLDINEGPLNNARNNVAK--ENLsDKCDFILSDGLK 75  Clostridium sp....
EIA28145       6 S-SNRIRHIINMCKYNE-TIIDVGCDHGYISIGLLNSNKCSRCYAVDINKDPINIAMNNIKK--YNLDTKIRCILSDGFN 81  Candidatus Arth...
WP_015465085   3 L-SKRLQSIFEQVKQPYtHIWDCCCDHGQLGFKLLGKDKAQHVHFVDINQNLMQKLEKKLQRyyQGSVSDWQVHCLDVSQ 81  Psychromonas sp...
CCY07486       1 --MKRLQTIAQKLK-PYrKIADIGCDHGYLIIEAFKISNDFEFIAIDNKIGPLNTCRENISK--LSYSDKVRFSLSSGIK 75  Coprobacillus s...
Q0AZ82        78 VLQ-PG--E-VA---TVIVAGMGGDNIAEILSRK--WSHSASYRk--FIFQPMSKTEVLRRELSQQGWPILEEKLLEEQQ 146 Syntrophomonas ...
WP_069569487  72 SVD-----KdYN---LAVITGMGPHLIIDILKEVmhLEDKT------YILGANEKIEVLRTWLSNNGFNIVDEYVIF-DG 136 Acholeplasma la...
WP_012359084  72 KIN-----QdFD---LALICGMGTYTIIKIMEQA-------PDKskhFLLGTQSKYQLLKQWLEQNNYLILEEHHLF-DK 135 Candidatus Phyt...
AHK22437      78 NIIdIAsyQ------YIIIAGLGGKTIEIILKNY--NDNAI------LILNPTNNEAILRKFLYDNKFKIEDEKLIYENN 143 Candidatus Hepa...
WP_015778063  78 GIN-KD--E-GQ---VAIIAGMGANTIIDIIEES--MDFSQNLDy--LILASNINTEKLRLFLVENDFEIMNDFLSFENK 146 Anaerococcus pr...
WP_002839046  78 NLN-EY--Q-VD---TIIISGMGGNLIVDILNKN--LDIAKSANc--LILGANNSLALLRRFLHENSFEIIEEVDLFEND 146 Finegoldia magna
CDE25397      76 NFN-----EeAD---VLVIAGMGGLLISNIILND--YEKVIKFKk--IIIDAHSEIEKLRANLISKYFVFDNEILIQDGK 143 Clostridium sp....
EIA28145      82 WF--DS--LeNT---SAVIAGMGGSTIASIINRN--INKIKYMNy--ILIQPNAYSKDIRKYLYDKQFHVEKEDVIYSKG 150 Candidatus Arth...
WP_015465085  82 LPLkNHqqSsLKethLIIIAGVGGQLLSTFLEALlpLNAQFNIE---FLICPVHHNFLVRETLIKHKLKLINELLIFEQG 158 Psychromonas sp...
CCY07486      76 DIN-----DdTE---VLVLAGMGGMLVCDILKDN-------IKNtqrIITCANRNNYNVRKYITSLGFKITDEDLVNENN 140 Coprobacillus s...
Q0AZ82       147 RIYLIL 152 Syntrophomonas wolfei subsp. wolfei str. Goettingen G311
WP_069569487 137 FYYVFL 142 Acholeplasma laidlawii
WP_012359084 136 FLYSFL 141 Candidatus Phytoplasma australiense
AHK22437     144 IYSIII 149 Candidatus Hepatoplasma crinochetorum Av
WP_015778063 147 KYYDII 152 Anaerococcus prevotii
WP_002839046 147 KYYQII 152 Finegoldia magna
CDE25397     144 HNYVII 149 Clostridium sp. CAG:307
EIA28145     151 IYYEYI 156 Candidatus Arthromitus sp. SFB-5
WP_015465085 159 RYYEIL 164 Psychromonas sp. CNPT3
CCY07486     141 KYYQII 146 Coprobacillus sp. CAG:698
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap