Conserved Protein Domain Family
Methyltransf_18

?
pfam12847: Methyltransf_18 
Methyltransferase domain
Protein in this family function as methyltransferases.
Statistics
?
PSSM-Id: 338519
View PSSM: pfam12847
Aligned: 222 rows
Threshold Bit Score: 113.293
Threshold Setting Gi: 500094141
Created: 31-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122318717    2 L-NKRLLTVSDSVIRGE-AAADIGADHGLLALFLLEKGIVPWVIASEVKEGPFERLRQAVEK--STFYERIELRLGNGLE 77
gi 1068466733   1 --MNRIAFIGELTK-GYeTVIDIGSDHGLVLKYALDHKYIKHAVASDINKGPLNHAKKNLAG--Y----PVRFYLSDGFK 71
gi 501327449    1 --MKRINFIASLTK-NYnTVLDIGTDHGFVLKKAFHEGYIKKAIASDLRIKPLLQSQKTLQN--Y----PVTFCLSDGFQ 71
gi 588284983    1 MfKGRIIEIADYISKNS-QVLDIGTDHGYIPLYLLKNKITDKITATDINTKPLLQAKKTLID--YKDLETLKFIKSNGFE 77
gi 506258288    2 EdKKRLLDIISLIDKNK-KVIDIGTDHGLVPLYLAKNGISKEILATDISEKSLDKLRGVLD---SDTEKFIQTMVTDGFK 77
gi 488927971    1 MkKLRLEEIIKLVEENS-IVADIGTDHGIVPYELVKSAKAKKVIASDISEKSLDKLREKLDYl-DEPEKIVLN-VSDGLD 77
gi 524721186    1 --MDRIELIASLAKDAN-SLVDCGCDHGYTAIKALKSYNVSHCYLLDINEGPLNNARNNVAK--ENLsDKCDFILSDGLK 75
gi 380339401    6 S-SNRIRHIINMCKYNE-TIIDVGCDHGYISIGLLNSNKCSRCYAVDINKDPINIAMNNIKK--YNLDTKIRCILSDGFN 81
gi 505277983    3 L-SKRLQSIFEQVKQPYtHIWDCCCDHGQLGFKLLGKDKAQHVHFVDINQNLMQKLEKKLQRyyQGSVSDWQVHCLDVSQ 81
gi 524025704    1 --MKRLQTIAQKLK-PYrKIADIGCDHGYLIIEAFKISNDFEFIAIDNKIGPLNTCRENISK--LSYSDKVRFSLSSGIK 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122318717   78 VLQ-PG--E-VA---TVIVAGMGGDNIAEILSRK--WSHSASYRk--FIFQPMSKTEVLRRELSQQGWPILEEKLLEEQQ 146
gi 1068466733  72 SVD-----KdYN---LAVITGMGPHLIIDILKEVmhLEDKT------YILGANEKIEVLRTWLSNNGFNIVDEYVIF-DG 136
gi 501327449   72 KIN-----QdFD---LALICGMGTYTIIKIMEQA-------PDKskhFLLGTQSKYQLLKQWLEQNNYLILEEHHLF-DK 135
gi 588284983   78 NIIdIAsyQ------YIIIAGLGGKTIEIILKNY--NDNAI------LILNPTNNEAILRKFLYDNKFKIEDEKLIYENN 143
gi 506258288   78 GIN-KD--E-GQ---VAIIAGMGANTIIDIIEES--MDFSQNLDy--LILASNINTEKLRLFLVENDFEIMNDFLSFENK 146
gi 488927971   78 NLN-EY--Q-VD---TIIISGMGGNLIVDILNKN--LDIAKSANc--LILGANNSLALLRRFLHENSFEIIEEVDLFEND 146
gi 524721186   76 NFN-----EeAD---VLVIAGMGGLLISNIILND--YEKVIKFKk--IIIDAHSEIEKLRANLISKYFVFDNEILIQDGK 143
gi 380339401   82 WF--DS--LeNT---SAVIAGMGGSTIASIINRN--INKIKYMNy--ILIQPNAYSKDIRKYLYDKQFHVEKEDVIYSKG 150
gi 505277983   82 LPLkNHqqSsLKethLIIIAGVGGQLLSTFLEALlpLNAQFNIE---FLICPVHHNFLVRETLIKHKLKLINELLIFEQG 158
gi 524025704   76 DIN-----DdTE---VLVLAGMGGMLVCDILKDN-------IKNtqrIITCANRNNYNVRKYITSLGFKITDEDLVNENN 140

                  ....*.
gi 122318717  147 RIYLIL 152
gi 1068466733 137 FYYVFL 142
gi 501327449  136 FLYSFL 141
gi 588284983  144 IYSIII 149
gi 506258288  147 KYYDII 152
gi 488927971  147 KYYQII 152
gi 524721186  144 HNYVII 149
gi 380339401  151 IYYEYI 156
gi 505277983  159 RYYEIL 164
gi 524025704  141 KYYQII 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap