Conserved Protein Domain Family
Mto2_bdg

?
pfam12808: Mto2_bdg 
Micro-tubular organizer Mto1 C-term Mto2-binding region
The C-terminal region of the micro-tubular organizer protein 1 (mto1) is the binding domain for attachment to Mto2p.The full-length Mto1 protein is required for microtubule nucleation from non-spindle pole body MTOCs in fission yeast. The interaction of Mto2p with this region of Mto1 is critical for anchoring the cytokinetic actin ring to the medial region of the cell and for proper coordination of mitosis with cytokinesis.
Statistics
?
PSSM-Id: 315477
View PSSM: pfam12808
Aligned: 8 rows
Threshold Bit Score: 57.8633
Threshold Setting Gi: 296804636
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEQ35434            1433 RWIQRLRDLERRLKAER-EARLLDRSGARERLAERNAENEKLRAALERERMNR 1484 Microsporum canis CBS 113480
Q4WWG0              1533 RWIHRLRELEKRLKAER-EARLLDRSGARKRLEERDAENQRLRAQLERQRMRR 1584 Aspergillus fumigatus
EDN06959            1677 KWIKRLQELERRLTAER-EARLLDRSGARKRLEEQNARNEELAAELARQKMRQ 1728 Histoplasma capsulatum NAm1
Q0U191              1499 KWIHRLKELERRLKAER-EARLLDRSGARKRLEQKVEENADLRAMLEKERELK 1550 Parastagonospora nodorum SN15
O94488              1052 IWQLRLREMEFQLKAEQ-EGRKRDKLGARERLQDLIRQNRSLSRQIKTDKESN 1103 Schizosaccharomyces pombe 972h-
WGS:AATM:SJAG_02737 1055 VWLARLRDMEFQLKAEQ-EARRRDNKGAKERLDELLKHNRDLTTQLSKDRAYA 1106 Schizosaccharomyces japonicus yFS275
XP_002843170        1282 KKLDRLEDMVRQMQNNR--RANTTPTSITAELAKLKGENRLLKAELNLLQSHS 1332 Microsporum canis CBS 113480
XP_001541392        1500 KKLERMEELVQNLKSSQpQHRSTPPNSCSAEISKLRGENRLLKAELNLLQSHS 1552 Histoplasma capsulatum NAm1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap