4RH7,5NUG,4AI6


Conserved Protein Domain Family
AAA_9

?
pfam12781: AAA_9 
Click on image for an interactive view with Cn3D
ATP-binding dynein motor region D5
The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D5 ATP-binding region of the motor, but has lost its P-loop.
Statistics
?
Aligned: 511 rows
Threshold Bit Score: 124.422
Threshold Setting Gi: 322798623
Created: 29-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RH7_A               2395 W-KSEGLPSDDLSIENALVIL--QS---RVCPFLIDPSSQATEWL-KTH-LKDSrLE--------VINQQDs-nFITA-L 2456 synth...
Q170I1                376 WcS-LGLPKDGLTVENATILLncN----LRSPLVVDPQGEIRRWL-VQ----------------------QdtkLISYnL 427  yello...
EEN60223             4064 L-ELQGLPTNPVALDSSCFVT--ETlsnNSWVLLCDPTSRAIPWL-TDY------LKeg----fiISKYHD----LKSqL 4125 Flori...
CCE61379             3378 WvQ-FGLPNEKFFIESFNMIIepPA----NYLLLVDPNGTIIPVL-SKVyGER--FS--------IFSFLDe-nYIKR-L 3439 Tetra...
LoveMIT:GQ68_00578T0 3411 WeA-FGLPRDNISIENMIILSq-----sSKFPFIIDPSGKIQNVL-TN--------Cisdq-ppiVTSFQDr-sFVRQ-L 3472 Komag...
ESW99608             3376 WqT-NGLPNDELFIENTMMMSa-----dRRFAFLIDPSGLMIDFM-EK--------Qyqd---ivVTSFLDd-gYVKL-L 3435 Ogata...
XP_001483477         3423 WkD-WGLSQDELNIQNIIIIEegi--ssGYVPLIVDPEDSIPTFI-SNlnsp---------qktvIASFLDp-sYVTS-V 3487 Meyer...
CCE44726             3399 WlE-NGLPDDELSKTNIALLSw------IDHPILIDPSGAIVDVI-AK--------Sypak-iltVAAFNNd-aFYNT-L 3459 Candi...
Q4YUJ6                464 L-SKQGLTLNSVCIENNIILE--NS---EKFPIIIDPQMESLKWLiNNQkEKSK-II--------ITDINDk-mLYKQ-I 526  Plasm...
XP_011276466         3348 WqN-QGLTNDALYFENVTILDh-----sDKIPLIIDPLGEIVEFL--K--------QhlapqkltITSFLDd-sFART-L 3409 Wicke...
4RH7_A               2457 ELAVRFGKTLIIQEM-DGV----EPVLYPLLRRDLVA---QgPr--YVVQI--------GD-KIIDY-NEEFRLFLSTRN 2516 synth...
Q170I1                428 DEE------RILSQV-EEFaqshQHIIAVNLREANINhfsQ-------LQTyhktyhsnKS-GTKQYaSA---LVVITTE 489  yello...
EEN60223             4126 ETCLTEGLFLILTDI-DLHllakDNRFNHVFRRRMSFl--T-GkapFKIIV--------GS-HEVEC-RPGFRLYMHTTC 4191 Flori...
CCE61379             3440 ENSIRFGEVALICDA-EYY----DSILDNIISKRYRSs--A-Gr--TSVII--------GS-KELDI-SKNFKLILHTKN 3499 Tetra...
LoveMIT:GQ68_00578T0 3473 ENALRFGSTIILQDA-EHY----DPIIRPILGNSFERig-----grKLIKI--------GEhK-IDF-SPKFKLILISKD 3532 Komag...
ESW99608             3436 ENCIRFGGSILIRDG-EHY----DPIVSRVIARDVETsg-----grSLVKL--------GSrE-IDL-SPKFQLFVHTKD 3495 Ogata...
XP_001483477         3488 ENALKFGTPILIKDA-EFY----NHNLDPILRRDFQRng-----grAVVKF--------NSnE-VDV-NPGFKLFMHTKD 3547 Meyer...
CCE44726             3460 ENSLRFGGVLVLEDA-EEL----NPIVNDLLRSTMHRnn-----grMMVEL--------AGkL-VDF-NPSFKLIMCTKE 3519 Candi...
Q4YUJ6                527 EECISYGYSIIIENAdEYI----DNTLYNVISKNIIKr--K-Sn--YYINI--------ND-KEIIF-HPDFYIILHTQL 587  Plasm...
XP_011276466         3410 ENTMRFGGNILVQDA-EYF----DPIISRLLNRDFEKvg-----grVLVKV--------GNrD-LDL-SPNFKIFLHTRD 3469 Wicke...
4RH7_A               2517 PNPF-IPPDAASI-VTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATS-QGNI 2593 synth...
Q170I1                490 EIPY--HNKLKKT-ANVINFILDKSGLEVKLLVTIIKHENPSLEERKEALEQMIISSNETITNLEENILHILNHSqLP-L 565  yello...
EEN60223             4192 M-PHeVPEEVAAY-TSLVNFYQDRSGIEAELLDRFIRLEKTRVQDERTNLAQEKIGNMERLALLEDQMLNLL-------- 4261 Flori...
CCE61379             3500 YDYN--IPSFMSNnLRVLNFKVSHASVEELTIKLSVENENANILKEYDEILSIERDTKTMLKIYGSQLLKELSSS-EGSI 3576 Tetra...
LoveMIT:GQ68_00578T0 3533 PSVI-IPSYVASR-TTILNFTITENSVVSQVLNNVLKIRYPVVDDQRIEVIKINSDYQIQLRSLEDELLDKLSES-EGNL 3609 Komag...
ESW99608             3496 ASAR-IPPYLEAR-MNVLNYTFTSSSLVNQALNMTLNSEQPSLEQQLVELSKLNGEYKESLYNLENDLLLSLSDT-RVSI 3572 Ogata...
XP_001483477         3548 SNLN-LSSFVASR-VLTVNFTISNSSLETQVLDLILKTFNLEIQKQRNEAISLQDKYEVLLHDIESDLLSTLNQA-DGRF 3624 Meyer...
CCE44726             3520 LGLE-LTEFVRSR-AGIINFSITSGSLENRVLDNALRVSHPKLEKQRAELILARSDITTQLQNLEDELLVSLNTK-AENI 3596 Candi...
Q4YUJ6                588 SNPH-YQPEIQST-CSLINFTVTPDDLEEHLLSITLQNEFNQLYKKKKKLSLLKYDYMCQLSFLQSSILQKLTDA-KGDI 664  Plasm...
XP_011276466         3470 PSVQ-ISSYVRAR-AMIIDYTLTESSIENQVVNMALSHMRPDVEEQRIELVKLEGEYKIRLADLENELLNSLSES-KGNL 3546 Wicke...
4RH7_A               2594 LENKDLIESLNQTKASS 2610 synthetic construct
Q170I1                566 IENEELYGTLQVSKQTA 582  yellow fever mosquito
EEN60223             4262 ASDTRLLNNLAVTKKLA 4278 Florida lancelet
CCE61379             3577 LENHNLVEILASMKMqs 3593 Tetrapisispora phaffii CBS 4417
LoveMIT:GQ68_00578T0 3610 LENSELLKTLESLKQES 3626 Komagataella phaffii GS115
ESW99608             3573 LENDELVKKLESIKHEA 3589 Ogataea parapolymorpha DL-1
XP_001483477         3625 LENDTVVDSLEEIKTRA 3641 Meyerozyma guilliermondii ATCC 6260
CCE44726             3597 LEDDKLLGTLETLNKNS 3613 Candida parapsilosis
Q4YUJ6                665 LEDVSLIENLEKTKLLS 681  Plasmodium berghei
XP_011276466         3547 LDNGDLVETLEKLKLES 3563 Wickerhamomyces ciferrii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap