4RH7,3VKH,4AI6


Conserved Protein Domain Family
AAA_9

?
pfam12781: AAA_9 
Click on image for an interactive view with Cn3D
ATP-binding dynein motor region D5
The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D5 ATP-binding region of the motor, but has lost its P-loop.
Statistics
?
PSSM-Id: 338486
View PSSM: pfam12781
Aligned: 507 rows
Threshold Bit Score: 124.039
Threshold Setting Gi: 751207701
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RH7_A       2395 W-KSEGLPSDDLSIENALVIL--QS---RVCPFLIDPSSQATEWL-KTH-LKDSrLE--------VINQQDs-nFITA-L 2456
Q170I1        376 WcS-LGLPKDGLTVENATILLncN----LRSPLVVDPQGEIRRWL-VQ----------------------QdtkLISYnL 427  yellow fever ...
Q4YUJ6        464 L-SKQGLTLNSVCIENNIILE--NS---EKFPIIIDPQMESLKWLiNNQkEKSK-II--------ITDINDk-mLYKQ-I 526  Plasmodium be...
XP_011276466 3348 WqN-QGLTNDALYFENVTILDh-----sDKIPLIIDPLGEIVEFL--K--------QhlapqkltITSFLDd-sFART-L 3409 Wickerhamomyc...
EDK40108     3423 WkD-WGLSQDELNIQNIIIIEegi--ssGYVPLIVDPEDSIPTFI-SNlnsp---------qktvIASFLDp-sYVTS-V 3487 Meyerozyma gu...
CCE44726     3399 WlE-NGLPDDELSKTNIALLSw------IDHPILIDPSGAIVDVI-AK--------Sypak-iltVAAFNNd-aFYNT-L 3459 Candida parap...
XP_002491674 3411 WeA-FGLPRDNISIENMIILSq-----sSKFPFIIDPSGKIQNVL-TN--------Cisdq-ppiVTSFQDr-sFVRQ-L 3472 Komagataella ...
XP_003683813 3378 WvQ-FGLPNEKFFIESFNMIIepPA----NYLLLVDPNGTIIPVL-SKVyGER--FS--------IFSFLDe-nYIKR-L 3439 Tetrapisispor...
XP_002604212 4064 L-ELQGLPTNPVALDSSCFVT--ETlsnNSWVLLCDPTSRAIPWL-TDY------LKeg----fiISKYHD----LKSqL 4125 Florida lancelet
XP_013251501  343 W-SLEGLPSDIASIENAILVW--NS---PKPPLIIDPDDQGTRWF-RKRhFKRE-FM--------EVSSSDa-dLLRS-L 404  Eimeria acerv...
4RH7_A       2457 ELAVRFGKTLIIQEM-DGV----EPVLYPLLRRDLVA---QgPr--YVVQI--------GD-KIIDY-NEEFRLFLSTRN 2516
Q170I1        428 DEE------RILSQV-EEFaqshQHIIAVNLREANINhfsQ-------LQTyhktyhsnKS-GTKQYaSA---LVVITTE 489  yellow fever ...
Q4YUJ6        527 EECISYGYSIIIENAdEYI----DNTLYNVISKNIIKr--K-Sn--YYINI--------ND-KEIIF-HPDFYIILHTQL 587  Plasmodium be...
XP_011276466 3410 ENTMRFGGNILVQDA-EYF----DPIISRLLNRDFEKvg-----grVLVKV--------GNrD-LDL-SPNFKIFLHTRD 3469 Wickerhamomyc...
EDK40108     3488 ENALKFGTPILIKDA-EFY----NHNLDPILRRDFQRng-----grAVVKF--------NSnE-VDV-NPGFKLFMHTKD 3547 Meyerozyma gu...
CCE44726     3460 ENSLRFGGVLVLEDA-EEL----NPIVNDLLRSTMHRnn-----grMMVEL--------AGkL-VDF-NPSFKLIMCTKE 3519 Candida parap...
XP_002491674 3473 ENALRFGSTIILQDA-EHY----DPIIRPILGNSFERig-----grKLIKI--------GEhK-IDF-SPKFKLILISKD 3532 Komagataella ...
XP_003683813 3440 ENSIRFGEVALICDA-EYY----DSILDNIISKRYRSs--A-Gr--TSVII--------GS-KELDI-SKNFKLILHTKN 3499 Tetrapisispor...
XP_002604212 4126 ETCLTEGLFLILTDI-DLHllakDNRFNHVFRRRMSFl--T-GkapFKIIV--------GS-HEVEC-RPGFRLYMHTTC 4191 Florida lancelet
XP_013251501  405 SEAVTAGMIVLVTLSePAL----DPALGALTNTVKVKp--E-Gr--TVVHV--------GD-HTALW-SPHFRMVLATKL 465  Eimeria acerv...
4RH7_A       2517 PNPF-IPPDAASI-VTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATS-QGNI 2593
Q170I1        490 EIPY--HNKLKKT-ANVINFILDKSGLEVKLLVTIIKHENPSLEERKEALEQMIISSNETITNLEENILHILNHSqLP-L 565  yellow fever ...
Q4YUJ6        588 SNPH-YQPEIQST-CSLINFTVTPDDLEEHLLSITLQNEFNQLYKKKKKLSLLKYDYMCQLSFLQSSILQKLTDA-KGDI 664  Plasmodium be...
XP_011276466 3470 PSVQ-ISSYVRAR-AMIIDYTLTESSIENQVVNMALSHMRPDVEEQRIELVKLEGEYKIRLADLENELLNSLSES-KGNL 3546 Wickerhamomyc...
EDK40108     3548 SNLN-LSSFVASR-VLTVNFTISNSSLETQVLDLILKTFNSEIQKQRNEAISLQDKYEVLLHDIESDLLSTLNQA-DGRF 3624 Meyerozyma gu...
CCE44726     3520 LGLE-LTEFVRSR-AGIINFSITSGSLENRVLDNALRVSHPKLEKQRAELILARSDITTQLQNLEDELLVSLNTK-AENI 3596 Candida parap...
XP_002491674 3533 PSVI-IPSYVASR-TTILNFTITENSVVSQVLNNVLKIRYPVVDDQRIEVIKINSDYQIQLRSLEDELLDKLSES-EGNL 3609 Komagataella ...
XP_003683813 3500 YDYN--IPSFMSNnLRVLNFKVSHASVEELTIKLSVENENANILKEYDEILSIERDTKTMLKIYGSQLLKELSSS-EGSI 3576 Tetrapisispor...
XP_002604212 4192 M-PHeVPEEVAAY-TSLVNFYQDRSGIEAELLDRFIRLEKTRVQDERTNLAQEKIGNMERLALLEDQMLNLL-------- 4261 Florida lancelet
XP_013251501  466 YPSE-LAPEMHNQ-LSVINFRVTPASLEEQLLNQIILHEAPYLEEQRGVLVVNIANDLELKAAIQEKILSLLANA-EGDI 542  Eimeria acerv...
4RH7_A       2594 LENKDLIESLNQTKASS 2610
Q170I1        566 IENEELYGTLQVSKQTA 582  yellow fever mosquito
Q4YUJ6        665 LEDVSLIENLEKTKLLS 681  Plasmodium berghei
XP_011276466 3547 LDNGDLVETLEKLKLES 3563 Wickerhamomyces ciferrii
EDK40108     3625 LENDTVVDSLEEIKTRA 3641 Meyerozyma guilliermondii ATCC 6260
CCE44726     3597 LEDDKLLGTLETLNKNS 3613 Candida parapsilosis
XP_002491674 3610 LENSELLKTLESLKQES 3626 Komagataella pastoris GS115
XP_003683813 3577 LENHNLVEILASMKMqs 3593 Tetrapisispora phaffii CBS 4417
XP_002604212 4262 ASDTRLLNNLAVTKKLA 4278 Florida lancelet
XP_013251501  543 LADDTFLDILNDSRLTy 559  Eimeria acervulina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap