Conserved Protein Domain Family
AAA_8

?
pfam12780: AAA_8 
P-loop containing dynein motor region D4
The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D4 ATP-binding region of the motor.
Statistics
?
PSSM-Id: 289546
View PSSM: pfam12780
Aligned: 3 rows
Threshold Bit Score: 567.264
Threshold Setting Gi: 172044714
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9NYC9    2788 HNEVNTVMDLVLFEDAMRHVCHINRILESPRGNALLVGVGGSGKQSLTRLAAFISSMDVFQITLRKGYQIQDFKMDLASL 2867 human
Q9UFH2    2750 YNEVNAVMNLVLFEDAVAHICRINRILESPRGNALLVGVGGSGKQSLSRLAAYISGLDVFQITLKKGYGIPDLKIDLAAQ 2829 human
XP_797783  504 YNEINAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLASYISSLEVFQITLRKGYGIPDLKLDLATV 583  purple sea urchin
Q9NYC9    2868 CLKAGVKNLNTVFLMTDAQVADERFLVLINDLLASGEIPDLYSDDEVENIISNVRNEVKSQGLVDNRENCWKFFIDRIRR 2947 human
Q9UFH2    2830 YIKAAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFMEDEVENIISSMRPQVKSLGMNDTRETCWKFFIEKVRR 2909 human
XP_797783  584 CMKAGLKNIGTTFLMTDAQVSDEKFLVLINDLLASGEIPDLFPDDEVENIIGGVRNEVKGQGLQDTRENCWRFFIDRLRR 663  purple sea urchin
Q9NYC9    2948 QLKVTLCFSPVGNKLRVRSRKFPAIVNCTAIHWFHEWPQQALESVSLRFLQNTEGIEPTVKQSISKFMAFVHTSVNQTSQ 3027 human
Q9UFH2    2910 QLKVILCFSPVGSVLRVRARKFPAVVNCTAIDWFHEWPEDALVSVSARFLEETEGIPWEVKASISFFMSYVHTTVNEMSR 2989 human
XP_797783  664 NLKTVLCFSPVGTTLRVRSRKFPAVVNCTSIDWFHEWPQEALVSVSMRFLEEVELLKGDIKGSIAEFMSFVHVSVNESSK 743  purple sea urchin
Q9NYC9    3028 SYLSNEQRYNYTTPKSFLEFIRLYQSLL 3055 human
Q9UFH2    2990 VYLATERRYNYTTPKTFLEQIKLYQNLL 3017 human
XP_797783  744 QYLTNERRYNYTTPKSFLEQIKLYESLL 771  purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap