Conserved Protein Domain Family
MT

?
pfam12777: MT 
Microtubule-binding stalk of dynein motor
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This family is the region between D4 and D5 and is the two predicted alpha-helical coiled coil segments that form the stalk supporting the ATP-sensitive microtubule binding component.
Statistics
?
PSSM-Id: 289543
View PSSM: pfam12777
Aligned: 3 rows
Threshold Bit Score: 691.386
Threshold Setting Gi: 1476413356
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9NYC9       3067 ERLENGLLKLHSTSAQVDDLKAKLAAQEVELKQKNEDADKLIQVVGVETDKVSREKAMADEEEQKVAVIMLEVKQKQKDC 3146 human
Q9UFH2       3029 ERLENGLMKLQSTASQVDDLKAKLAIQEAELKQKNESADQLIQVVGIEAEKVSKEKAIADQEEVKVEVINKNVTEKQKAC 3108 human
XP_011680580 3028 ERLENGLTKLQSTAQQVDDLKAKLASQEVELAQKNEDADKLIQVVGVETEKVSKEKAIADDEEKKVAIINDEVSKKAKDC 3107 purple sea ur...
Q9NYC9       3147 EEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPPLAVSNVSAAVMVLMAPRGRVPKDRSWKAAKVTMAKVDGFLDSLI 3226 human
Q9UFH2       3109 ETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKIMMGKVDTFLDSLK 3188 human
XP_011680580 3108 TEDLAKAEPALLAAQEALNTLNKTNITELKSFGSPPPAVLKVAAAVMVLLAPNGKVPKDRSWKAAKIVMNKVDAFLDALI 3187 purple sea ur...
Q9NYC9       3227 NFNKENIHENCLKAIRPYLQDPEFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATADLTAAQEKLAAI 3306 human
Q9UFH2       3189 KFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRI 3268 human
XP_011680580 3188 NYDKENIHENCQKAIKEYLNDPEFEPEFIKGKSLAAGGLCSWVVNIVKFYNVYCDVEPKRIALQKANDELKAAQDKLVII 3267 purple sea ur...
Q9NYC9       3307 KAKIAHLNENLAKLTARFEKATADKLKCQQEAEVTAVTISLANRLVGGLASENVRWADAVQNFKQQERTLCGDILLITAF 3386 human
Q9UFH2       3269 KNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVILLANRLVGGLASENIRWAESVENFRSQGVTLCGDVLLISAF 3348 human
XP_011680580 3268 KAKIAELDANLAELTASFEKATSDKLKCQQEAESTSRTITLANRLVGGLASENVRWGEAVANFKIQEKTLPGDVLLITAF 3347 purple sea ur...
Q9NYC9       3387 ISYLGFFTKKYRQSLLDRTWRPYL 3410 human
Q9UFH2       3349 VSYVGYFTKKYRNELMEKFWIPYI 3372 human
XP_011680580 3348 VSYIGCFTKNYRLDLQDRMWLPFL 3371 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap