Conserved Protein Domain Family
AAA_7

?
pfam12775: AAA_7 
P-loop containing dynein motor region D3
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D3 and is an ATP binding site.
Statistics
?
PSSM-Id: 289541
View PSSM: pfam12775
Aligned: 3 rows
Threshold Bit Score: 584.21
Threshold Setting Gi: 311033454
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9NYC9       2439 FEFDPEMPLQACLVHTSETIRVCYFMERLMARQRPVMLVGTAGTGKSVLVGAKLASLDPEAYLVKNVPFNYYTTSAMLQA 2518 human
Q9UFH2       2402 FELDPDVPLQASLVHTTETIRIRYFMDLLMEKSWPVMLVGNAGTGKSVLMGDKLESLNTDNYLVQAVPFNFYTTSAMLQG 2481 human
1_pfamImport    1 FELDPDIPLQAVLVHTNETTRVRYFMDMLMERGRPVMLVGNAGLGKSVLVGDKLANLGDES-MVANVPFNYYTTSEMLQR 79  
Q9NYC9       2519 VLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPEVDAYGTVQPHTIIRQHLDYGHWYDRSKLSLKEITNVQYVSCMNPTAG 2598 human
Q9UFH2       2482 VLEKPLEKKSGRNYGPPGTKKLVYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRHKLTLKDIHNCQYVACMNPTSG 2561 human
1_pfamImport   80 VLEKPLEKKAGRNYGPPGTKKLIYFIDDMNMPEVDTYGTVQPHTMIRQHMDYHHWYDRTKLTLKEIHKCQYVSCMNPTSG 159 
Q9NYC9       2599 SFTINPRLQRHFSVFVLSFPGADALSSIYSIILTQHLKLGNFPASLQKSIPPLIDLALAFHQKIATTFLPTGIKFHYIFN 2678 human
Q9UFH2       2562 SFTIDSRLQRHFCVFAVSFPGQEALTTIYNTILTQHLAFRSVSMAIQRISSQLVAAALALHQKITATFLPTAIKFHYVFN 2641 human
1_pfamImport  160 SFTINSRLQRHFCVFALSFPGQDALATIYNSILSQHLANISVSNALQKLSMTVVSATLDLHKKVAQSFLPTAVKFHYVFN 239 
Q9NYC9       2679 LRDFANIFQGILFSSVECVKSTWDLIRLYLHE 2710 human
Q9UFH2       2642 LRDLSNIFQGLLFSTAEVLKTPLDLVRLWLHE 2673 human
1_pfamImport  240 LRDLSNVFQGLLYSGPELLKAPIDLIRLWMHE 271 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap