Conserved Protein Domain Family
AAA_6

?
pfam12774: AAA_6 
Hydrolytic ATP binding site of dynein motor region D1
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D1 unit of the motor and contains the hydrolytic ATP binding site.
Statistics
?
Aligned: 117 rows
Threshold Bit Score: 407.224
Threshold Setting Gi: 357522108
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EAY15861     1450 YGYEYQGNAPKLVHTPLTDICWSTLCEGMHLGFAGNPYGPAGTGKTESVKALGQAMGRQVLVFNCGDGIDVKSICRIFTG 1529 Trichomonas v...
KOX75896     1112 YGYEYSYHKQHLVNTPLTNRCFHTLMQAYEYHLYGAITGPSATGKSETIKSLAKAFAVQFRSFNCINTLSYNFVTQIFKG 1191 Melipona quad...
EZA60901      870 YGYEYNFYQQNIVNTPLTDRCFRTILQAYRYHLYGSITGPTDTGKTETVRNLTMALAKPFYVINCDNSISYDCILKTFKG 949  clonal raider...
EFN82623      997 YGYEYSHYQQVVINTPLTDRCFRAVMQAYRYHLFSIIIGPTGAGKTEAIKSLTSTLAKPFYLVSCSHDVSYEYVAQTLKG 1076 Jerdon's jump...
KYQ58466     1125 YEYEYNCCQQNIVNTPLTDRCFRTILQAYRYHLYSSIIGPTGTGKTETIKSLTRAIAKPYYVINCNNSISYECVIRTFKG 1204 Trachymyrmex ...
CAP30931     2185 YTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTG 2264 Caenorhabditi...
KNE55585     1413 YSFEYQGNPSKLVQTPLTDTCFATLMQAMSEGLGGCLYGPAGTGKTESVKSLGYLLGRQVLVFNCDEALDVSSITRLFCG 1492 Allomyces mac...
XP_017990903 1792 YGFEVLGAQERLIPTPLTNASYITLTQALKARQGGAPFGPAGTGKTETVKALGAELGRWVLVFNCDQQFDESAMARLLLG 1871 Malassezia pa...
EFC48313     1846 YGFEYLGVIEKLVQTPLTDKCYLALTQALHSRFGGSPFGPAGTGKTETVKALGAQLGRFVLVFNCDETFDFKAMGRIFLG 1925 Naegleria gru...
CCE61379     1758 YSYSYIGVPENLIRTESLLTAYVSLMHAFDQNYGSSLFGPAATGKTETTKSLGHSLGKTVVIFNCDDSFDIDSLTRIMGG 1837 Tetrapisispor...
EAY15861     1530 LVQCGAWGCFDEFNRLDELVLSAVSQQIQAIQTAILKKKENVALLGKTIP-LDLKSGIFVTLNPagkAYGGRSKLPNNLK 1608 Trichomonas v...
KOX75896     1192 FISCGAWLCFVNFNTLKIDFLSRLAQILTSVFYIIATNLKITMFEGSSLR-INQIGHICIITKL---SLFKCPNIPDNLK 1267 Melipona quad...
EZA60901      950 VVSCGAWICFKNFNKLKLELLSAIAQNLTQMMQAVSSNLKTVSFEGCNLD-LDASGNICINISL---EQSKHTDLPDNLK 1025 clonal raider...
EFN82623     1077 AVSCGAWICLENFDGLKLELLSAIAQNLSQMKQAVSSRLKTVNLDGCVLN-LNASGNVCVNINS---ERSRHSNLPGNLK 1152 Jerdon's jump...
KYQ58466     1205 VISCGAWICFENFNRLKLELLSSIAQNLIQMKQAVSSKLKIISFEGCDLN-LNVSGNICVNINS---EQSGYADLPDNLK 1280 Trachymyrmex ...
CAP30931     2265 IVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQ-VNPNSAIFVTLNPagkGYGGRQKMPDNLK 2343 Caenorhabditi...
KNE55585     1493 IVKCGAWGCFDEFNRLSAGVLAAVSNLVSTIQQALLKRFPTVQIAGTELT-VNHSSCLFVTLNPagkQYKGRQQLPNNLK 1571 Allomyces mac...
XP_017990903 1872 LARVGAWGCFDEFNRLDERVLSSVSQSMQAVQQALAHETEA-RI-GSVLTrVQPSTGLFVTMNP---SYAGRSHLPDNLV 1946 Malassezia pa...
EFC48313     1926 LCQCGSWGCFDEFNRLNEKMMSAVSQQIQTIQIALRDRKTSIELIGRQCS-VHDNTGIFITMNP---GYAGRSNLPDNLK 2001 Naegleria gru...
CCE61379     1838 ICQLGVWCCFDEFNRLPKAILSAVASYLEAIQFSLTRSLNSVQLRQSSFK-LHKDSRFIVTLNP---TYEGRSELPTNLK 1913 Tetrapisispor...
EAY15861     1609 ALFRSVSMSAPDKALIGEIMLYSEGFQASTELAQRLTTTFSLADQLL-SKQRHYDWGLRAQKTVLNMAGQWLRE--SDGs 1685 Trichomonas v...
KOX75896     1268 ILFRTVTMIVPDMNKIVEVEFFAGGMSNSKLLTSKLVSLYKILSEQL-WCQSCNIFNLYSMKTIVKTTIYLKRS--FPD- 1343 Melipona quad...
EZA60901     1026 VLFRSVSMIAPDIYKIVEVGLFAGGFLHAKDLAAKLVVSYKLLTDHLrGKHYFYNLGASSLKTVIAAATSMKRN--IPN- 1102 clonal raider...
EFN82623     1153 VLFRPVAMMVPDVGRIAEVVLFAGGFLHAKDLAMKLTLTYKLLSEHL-EEKNCYNLGLSSLKTVIETAISMKRN--LSE- 1228 Jerdon's jump...
KYQ58466     1281 ILFRSVSMISPDIGKIAEIELFAGGFNHAKNLATKLAVSYKLLSEHM-GDKRHYNFSMSSLKTVVETAINMKRN--IPN- 1356 Trachymyrmex ...
CAP30931     2344 QLFRAVVMGKPDNELISSTILYSEGFVDATSLARKIVSVFQLSRQML-SKQQHYDWGLRALKVVLGGCGALRRA--QPN- 2419 Caenorhabditi...
KNE55585     1572 QLFRNIAMTHPDVTYICQIELKAQGFDNTDDLGKVVVEFYDACRKIL-SVQSHYDWGLRALKAVLMTAGSLRRs-aGQG- 1648 Allomyces mac...
XP_017990903 1947 KLFRRVAMTQPDSTLIVEGWLRMHGFTDASSLACKMVTLFQLCMEQL-SDAPHYDFGLRALKAVLVGAAHARRS--NPA- 2022 Malassezia pa...
EFC48313     2002 QLFRNIAMVKPDKELIAQVILYSQGFKLAEELSKKVVLFFDLCRDKL-SHQSHYDFGLRALKSVLVNAGYLKRNfsSTN- 2079 Naegleria gru...
CCE61379     1914 KLFRSFSMSHADLYTISSVYLEMMGYPDWSDLSKTLSNLMLELDKQC-TKQLHYDFGLRCLKTILRNAQILKKKdvHSR- 1991 Tetrapisispor...
EAY15861     1686 QNEADIVIRALLFDTLGKLDDKDRSLFLDIVKDIFKTQdaNANN--EN--SLQDTINEIIKEKK-LQPSQQQLTKIALLH 1760 Trichomonas v...
KOX75896     1344 QNEIVLLLRSLIDVNLPKLCNIDTHIFRNIVHDMFPNV--TLLP--SDytVFLETLETVCTSKSiYI-HDIFKLKIIQIF 1418 Melipona quad...
EZA60901     1103 ENEYTLLLRSMIDVNIPQLCNTDVPIFQSIIRNVFPEP--SMPP--FDcsTILNALEKVCAKRF-LTLHSVFKLKVIQII 1177 clonal raider...
EFN82623     1229 ENEYTLLLRSIIDINIPQLCNTDVIIFQDIMQDVFPEs-vMLP---FDhsAISSALEDVCAKRR-LTLHNIFKLKAIQTI 1303 Jerdon's jump...
KYQ58466     1357 ENEYTLLLRSMIHINIPQLCNTDISIFQNIMQDIFPES--DVLP--FDcsAILNALEIVCTKRL-LTLHTVFKLKAIQII 1431 Trachymyrmex ...
CAP30931     2420 KNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFANV----TKemTKfeELVEPLGVAAKEIG-ISLGEKQMEKVFQLY 2494 Caenorhabditi...
KNE55585     1649 VSGSDVLAEAMRVSTESKLTGPDKQVFLGLLSLYFGS---EGNR--STtgDFVRAMADAYKQLG-LTPLDWQIQAGFQLH 1722 Allomyces mac...
XP_017990903 2023 ESEINVIVQSVQETVPPRLVAEDAPLFAELVADVFPGI----APssSMskDLVQALEAECEAQH-LG-TGAWLEKIWQLH 2096 Malassezia pa...
EFC48313     2080 I-ESKHLIQSIQDTIIPKLVGDDVSQLKFLISNLFPGL--ETVS--NPltELRQYIFEICNLYSyLA-DERWVEKIVQLY 2153 Naegleria gru...
CCE61379     1992 LK---VLLNSIIQVISPKLNMDDTVLLHHLIRKYFNV---DLPH--IDndMFISTLVNQM--PYkYS-A-HFIQLCKHLY 2059 Tetrapisispor...
EAY15861     1761 QLLQHRTGAVIVGPAGCGKS 1780 Trichomonas vaginalis G3
KOX75896     1419 ELMHIHQCLILVGDPFVGKT 1438 Melipona quadrifasciata
EZA60901     1178 ELTYVRRGLILIGNPLAGKT 1197 clonal raider ant
EFN82623     1304 ELMYVHRALVLVGEPLSGKT 1323 Jerdon's jumping ant
KYQ58466     1432 ELMNVHRGLILISNSLGGKT 1451 Trachymyrmex zeteki
CAP30931     2495 EQMRQRIGVVVVGAAGSGKS 2514 Caenorhabditis briggsae
KNE55585     1723 TSCAQRMGVCIVGLPRSGKV 1742 Allomyces macrogynus ATCC 38327
XP_017990903 2097 HVLDIAPGVVLVGEAGTGKT 2116 Malassezia pachydermatis
EFC48313     2154 NIQNLHHGFICVGPAASGKS 2173 Naegleria gruberi
CCE61379     2060 ELQGINQSVIIMGKTGSGKS 2079 Tetrapisispora phaffii CBS 4417
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap