Conserved Protein Domain Family
AAA_6

?
pfam12774: AAA_6 
Hydrolytic ATP binding site of dynein motor region D1
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D1 unit of the motor and contains the hydrolytic ATP binding site.
Statistics
?
PSSM-Id: 289540
View PSSM: pfam12774
Aligned: 2 rows
Threshold Bit Score: 490.739
Threshold Setting Gi: 311033454
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9NYC9 1832 YSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGILVYVFNCSEQMDYKSCGNIYKG 1911 human
Q9NYC9 1832 YSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGILVYVFNCSEQMDYKSCGNIYKG 1911 human
Q9NYC9 1912 LAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKQWFSFLGEEISLNPSVGIFITMNPGYAGRTELPENLKSLFR 1991 human
Q9NYC9 1912 LAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKQWFSFLGEEISLNPSVGIFITMNPGYAGRTELPENLKSLFR 1991 human
Q9NYC9 1992 PCAMVVPDFELICEIMLVAEGFIEAQSLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDP 2062 human
Q9NYC9 1992 PCAMVVPDFELICEIMLVAEGFIEAQSLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDP 2062 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap