Conserved Protein Domain Family
EF-hand_4

?
pfam12763: EF-hand_4 
Cytoskeletal-regulatory complex EF hand
This is an efhand family from the N-terminal of actin cytoskeleton-regulatory complex END3 and similar proteins from fungi and closely related species.
Statistics
?
Aligned: 13 rows
Threshold Bit Score: 161.772
Threshold Setting Gi: 254580635
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6C370                 1 MSaqgKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKNSNLSEDKLAKIWDLADVDSDGCLDFEEFCITMRLIFDLLN 80  Yarrowi...
A3M008                 1 MP---RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKNSRLQDDQLAKIWELSDIDSDGKLDFEEFCITMRLIFDMVN 77  Scheffe...
Q6BY77                 1 MP---RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKNSRLKDDQLSQIWDLSDIDSDGKLDFEEFCITMRLIFDLVN 77  Debaryo...
LoveMIT:GQ68_04400T0   1 MPe--KLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLNTDQLALIWDLSDIDQDGELDFEEFCIAMRLIFDLVN 78  Komagat...
Q9USZ7                 1 MD------PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLIN 74  Schizos...
A6RFP4                 1 MSe-kKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRNSRLRDDQLEKVWDLADVDGDGELDFEEFCVAMRLIFDLVN 79  Histopl...
P0CT09                 2 aP---RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKNSGLRDDQLERVWDLADVDNDGNLDFEEFCVAMRVIFDILN 78  Pyricul...
XP_002615535           1 MP---RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKNSRLPEAQLARLWDLADIDSDGTLDFEEFCIAMRLIFDLVN 77  Clavisp...
A5DF78                 1 MP---QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKNSQLPQDKLSKIWELSDIDSDGNLDFEEFCIAMRLIFDIVN 77  Meyeroz...
Q755V2                 1 MP---KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHNSKLEAGVLGKIWFLSDIDGDGNLDFEEFVICMRLIFDMVN 77  Eremoth...
XP_002496303           1 MP---KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFNSKLDSSVLNKIWFLADIDEDDDLDFEEFVICMRLIFDMVN 77  Zygosac...
A5DXI9                 1 MP---RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKNSRLPQQQLASVWTLSDIDNDGKLDFEEFCITMRLIFDLIN 77  Loddero...
Q5AJ82                 1 MP---RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKNSQLPQQQLSAIWELSDIDNDGKLDFEEFCIIMRLIFDVIN 77  Candida...
Q6C370                81 NNINDVPSTLPQWLVPQSKAHLIEANK 107 Yarrowia lipolytica CLIB122
A3M008                78 GVSTAIPKELPSWLIPSSKAHLIQANN 104 Scheffersomyces stipitis CBS 6054
Q6BY77                78 GNQQSLPSELPSWLVPASKAHLIQANM 104 Debaryomyces hansenii CBS767
LoveMIT:GQ68_04400T0  79 GTIAELPSTLPNWLVPGSKAHLVQANS 105 Komagataella phaffii GS115
Q9USZ7                75 GVYKTVPDRVPEALVSTSKKHLVAARD 101 Schizosaccharomyces pombe 972h-
A6RFP4                80 GEYADVPHSLPDWLIPESKAHLVQASR 106 Histoplasma capsulatum NAm1
P0CT09                79 GEHADVPSTLPDWLVPESKAHLVQANR 105 Pyricularia oryzae 70-15
XP_002615535          78 GNMDDVPAELPAWLVPQSKRHLIDANK 104 Clavispora lusitaniae ATCC 42720
A5DF78                78 GSQSDVPAELPGWLIPASKAYLIQANR 104 Meyerozyma guilliermondii ATCC 6260
Q755V2                78 QNITAVPDELPDWLVPGSKVELVRQRA 104 Eremothecium gossypii ATCC 10895
XP_002496303          78 KNISSVPDELPDWLVPGSKVSMIKERR 104 Zygosaccharomyces rouxii
A5DXI9                78 GSISEVPLQLPLWLIPSSKAALIQANQ 104 Lodderomyces elongisporus NRRL YB-4239
Q5AJ82                78 GKLPNVPQELPSWLIPASKSAIIQANK 104 Candida albicans SC5314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap