Conserved Protein Domain Family
EF-hand_4

?
pfam12763: EF-hand_4 
Cytoskeletal-regulatory complex EF hand
This is an efhand family from the N-terminal of actin cytoskeleton-regulatory complex END3 and similar proteins from fungi and closely related species.
Statistics
?
PSSM-Id: 289529
View PSSM: pfam12763
Aligned: 13 rows
Threshold Bit Score: 161.772
Threshold Setting Gi: 238939194
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6C370                 1 MSaqgKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKNSNLSEDKLAKIWDLADVDSDGCLDFEEFCITMRLIFDLLN 80  Yarrowi...
A3M008                 1 MP---RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKNSRLQDDQLAKIWELSDIDSDGKLDFEEFCITMRLIFDMVN 77  Scheffe...
Q6BY77                 1 MP---RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKNSRLKDDQLSQIWDLSDIDSDGKLDFEEFCITMRLIFDLVN 77  Debaryo...
LoveMIT:GQ68_04400T0   1 MPe--KLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLNTDQLALIWDLSDIDQDGELDFEEFCIAMRLIFDLVN 78  Komagat...
Q9USZ7                 1 MD------PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLIN 74  Schizos...
A6RFP4                 1 MSe-kKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRNSRLRDDQLEKVWDLADVDGDGELDFEEFCVAMRLIFDLVN 79  Histopl...
P0CT09                 2 aP---RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKNSGLRDDQLERVWDLADVDNDGNLDFEEFCVAMRVIFDILN 78  Pyricul...
EEQ40289               1 MP---RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKNSRLPEAQLARLWDLADIDSDGTLDFEEFCIAMRLIFDLVN 77  Clavisp...
A5DF78                 1 MP---QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKNSQLPQDKLSKIWELSDIDSDGNLDFEEFCIAMRLIFDIVN 77  Meyeroz...
Q755V2                 1 MP---KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHNSKLEAGVLGKIWFLSDIDGDGNLDFEEFVICMRLIFDMVN 77  Eremoth...
CAR27370               1 MP---KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFNSKLDSSVLNKIWFLADIDEDDDLDFEEFVICMRLIFDMVN 77  Zygosac...
A5DXI9                 1 MP---RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKNSRLPQQQLASVWTLSDIDNDGKLDFEEFCITMRLIFDLIN 77  Loddero...
Q5AJ82                 1 MP---RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKNSQLPQQQLSAIWELSDIDNDGKLDFEEFCIIMRLIFDVIN 77  Candida...
Q6C370                81 NNINDVPSTLPQWLVPQSKAHLIEANK 107 Yarrowia lipolytica CLIB122
A3M008                78 GVSTAIPKELPSWLIPSSKAHLIQANN 104 Scheffersomyces stipitis CBS 6054
Q6BY77                78 GNQQSLPSELPSWLVPASKAHLIQANM 104 Debaryomyces hansenii CBS767
LoveMIT:GQ68_04400T0  79 GTIAELPSTLPNWLVPGSKAHLVQANS 105 Komagataella phaffii GS115
Q9USZ7                75 GVYKTVPDRVPEALVSTSKKHLVAARD 101 Schizosaccharomyces pombe 972h-
A6RFP4                80 GEYADVPHSLPDWLIPESKAHLVQASR 106 Histoplasma capsulatum NAm1
P0CT09                79 GEHADVPSTLPDWLVPESKAHLVQANR 105 Pyricularia oryzae 70-15
EEQ40289              78 GNMDDVPAELPAWLVPQSKRHLIDANK 104 Clavispora lusitaniae ATCC 42720
A5DF78                78 GSQSDVPAELPGWLIPASKAYLIQANR 104 Meyerozyma guilliermondii ATCC 6260
Q755V2                78 QNITAVPDELPDWLVPGSKVELVRQRA 104 Eremothecium gossypii ATCC 10895
CAR27370              78 KNISSVPDELPDWLVPGSKVSMIKERR 104 Zygosaccharomyces rouxii
A5DXI9                78 GSISEVPLQLPLWLIPSSKAALIQANQ 104 Lodderomyces elongisporus NRRL YB-4239
Q5AJ82                78 GKLPNVPQELPSWLIPASKSAIIQANK 104 Candida albicans SC5314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap