Conserved Protein Domain Family
EF-hand_4

?
pfam12763: EF-hand_4 
Cytoskeletal-regulatory complex EF hand
This is an efhand family from the N-terminal of actin cytoskeleton-regulatory complex END3 and similar proteins from fungi and closely related species.
Statistics
?
PSSM-Id: 289529
View PSSM: pfam12763
Aligned: 13 rows
Threshold Bit Score: 161.772
Threshold Setting Gi: 238939194
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6C370         1 MSaqgKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKNSNLSEDKLAKIWDLADVDSDGCLDFEEFCITMRLIFDLLN 80  Yarrowia lipoly...
A3M008         1 MP---RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKNSRLQDDQLAKIWELSDIDSDGKLDFEEFCITMRLIFDMVN 77  Scheffersomyces...
Q6BY77         1 MP---RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKNSRLKDDQLSQIWDLSDIDSDGKLDFEEFCITMRLIFDLVN 77  Debaryomyces ha...
Q9USZ7         1 MD------PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLIN 74  Schizosaccharom...
A6RFP4         1 MSe-kKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRNSRLRDDQLEKVWDLADVDGDGELDFEEFCVAMRLIFDLVN 79  Histoplasma cap...
P0CT09         2 aP---RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKNSGLRDDQLERVWDLADVDNDGNLDFEEFCVAMRVIFDILN 78  Magnaporthe ory...
A5DF78         1 MP---QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKNSQLPQDKLSKIWELSDIDSDGNLDFEEFCIAMRLIFDIVN 77  Meyerozyma guil...
Q755V2         1 MP---KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHNSKLEAGVLGKIWFLSDIDGDGNLDFEEFVICMRLIFDMVN 77  Eremothecium go...
A5DXI9         1 MP---RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKNSRLPQQQLASVWTLSDIDNDGKLDFEEFCITMRLIFDLIN 77  Lodderomyces el...
Q5AJ82         1 MP---RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKNSQLPQQQLSAIWELSDIDNDGKLDFEEFCIIMRLIFDVIN 77  Candida albican...
XP_002496303   1 MP---KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFNSKLDSSVLNKIWFLADIDEDDDLDFEEFVICMRLIFDMVN 77  Zygosaccharomyc...
XP_002615535   1 MP---RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKNSRLPEAQLARLWDLADIDSDGTLDFEEFCIAMRLIFDLVN 77  Clavispora lusi...
XP_002493525   1 MPe--KLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLNTDQLALIWDLSDIDQDGELDFEEFCIAMRLIFDLVN 78  Komagataella pa...
Q6C370        81 NNINDVPSTLPQWLVPQSKAHLIEANK 107 Yarrowia lipolytica CLIB122
A3M008        78 GVSTAIPKELPSWLIPSSKAHLIQANN 104 Scheffersomyces stipitis CBS 6054
Q6BY77        78 GNQQSLPSELPSWLVPASKAHLIQANM 104 Debaryomyces hansenii CBS767
Q9USZ7        75 GVYKTVPDRVPEALVSTSKKHLVAARD 101 Schizosaccharomyces pombe 972h-
A6RFP4        80 GEYADVPHSLPDWLIPESKAHLVQASR 106 Histoplasma capsulatum NAm1
P0CT09        79 GEHADVPSTLPDWLVPESKAHLVQANR 105 Magnaporthe oryzae 70-15
A5DF78        78 GSQSDVPAELPGWLIPASKAYLIQANR 104 Meyerozyma guilliermondii ATCC 6260
Q755V2        78 QNITAVPDELPDWLVPGSKVELVRQRA 104 Eremothecium gossypii ATCC 10895
A5DXI9        78 GSISEVPLQLPLWLIPSSKAALIQANQ 104 Lodderomyces elongisporus NRRL YB-4239
Q5AJ82        78 GKLPNVPQELPSWLIPASKSAIIQANK 104 Candida albicans SC5314
XP_002496303  78 KNISSVPDELPDWLVPGSKVSMIKERR 104 Zygosaccharomyces rouxii CBS 732
XP_002615535  78 GNMDDVPAELPAWLVPQSKRHLIDANK 104 Clavispora lusitaniae ATCC 42720
XP_002493525  79 GTIAELPSTLPNWLVPGSKAHLVQANS 105 Komagataella pastoris GS115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap