Conserved Protein Domain Family
EF-hand_4

?
pfam12763: EF-hand_4 
Cytoskeletal-regulatory complex EF hand
This is an efhand family from the N-terminal of actin cytoskeleton-regulatory complex END3 and similar proteins from fungi and closely related species.
Statistics
?
PSSM-Id: 289529
View PSSM: pfam12763
Aligned: 13 rows
Threshold Bit Score: 161.772
Threshold Setting Gi: 254580635
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74689363    1 MSaqgKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKNSNLSEDKLAKIWDLADVDSDGCLDFEEFCITMRLIFDLLN 80
gi 205716859   1 MP---RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKNSRLQDDQLAKIWELSDIDSDGKLDFEEFCITMRLIFDMVN 77
gi 218512042   1 MP---RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKNSRLKDDQLSQIWDLSDIDSDGKLDFEEFCITMRLIFDLVN 77
gi 74625890    1 MD------PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLIN 74
gi 205716947   1 MSe-kKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRNSRLRDDQLEKVWDLADVDGDGELDFEEFCVAMRLIFDLVN 79
gi 544604083   2 aP---RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKNSGLRDDQLERVWDLADVDNDGNLDFEEFCVAMRVIFDILN 78
gi 205716848   1 MP---QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKNSQLPQDKLSKIWELSDIDSDGNLDFEEFCIAMRLIFDIVN 77
gi 442570147   1 MP---KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHNSKLEAGVLGKIWFLSDIDGDGNLDFEEFVICMRLIFDMVN 77
gi 205716453   1 MP---RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKNSRLPQQQLASVWTLSDIDNDGKLDFEEFCITMRLIFDLIN 77
gi 74680302    1 MP---RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKNSQLPQQQLSAIWELSDIDNDGKLDFEEFCIIMRLIFDVIN 77
gi 254580635   1 MP---KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFNSKLDSSVLNKIWFLADIDEDDDLDFEEFVICMRLIFDMVN 77
gi 260942473   1 MP---RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKNSRLPEAQLARLWDLADIDSDGTLDFEEFCIAMRLIFDLVN 77
gi 254572832   1 MPe--KLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLNTDQLALIWDLSDIDQDGELDFEEFCIAMRLIFDLVN 78
                         90       100
                 ....*....|....*....|....*..
gi 74689363   81 NNINDVPSTLPQWLVPQSKAHLIEANK 107
gi 205716859  78 GVSTAIPKELPSWLIPSSKAHLIQANN 104
gi 218512042  78 GNQQSLPSELPSWLVPASKAHLIQANM 104
gi 74625890   75 GVYKTVPDRVPEALVSTSKKHLVAARD 101
gi 205716947  80 GEYADVPHSLPDWLIPESKAHLVQASR 106
gi 544604083  79 GEHADVPSTLPDWLVPESKAHLVQANR 105
gi 205716848  78 GSQSDVPAELPGWLIPASKAYLIQANR 104
gi 442570147  78 QNITAVPDELPDWLVPGSKVELVRQRA 104
gi 205716453  78 GSISEVPLQLPLWLIPSSKAALIQANQ 104
gi 74680302   78 GKLPNVPQELPSWLIPASKSAIIQANK 104
gi 254580635  78 KNISSVPDELPDWLVPGSKVSMIKERR 104
gi 260942473  78 GNMDDVPAELPAWLVPQSKRHLIDANK 104
gi 254572832  79 GTIAELPSTLPNWLVPGSKAHLVQANS 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap