Conserved Protein Domain Family
Vac14_Fab1_bd

?
pfam12755: Vac14_Fab1_bd 
Vacuolar 14 Fab1-binding region
Vac14 is a scaffold for the Fab1 kinase complex, a complex that allows for the dynamic interconversion of PI3P and PI(3,5)P2p (phosphoinositide phosphate (PIP) lipids, that are generated transiently on the cytoplasmic face of selected intracellular membranes). This interconversion is regulated by at least five proteins in yeast: the lipid kinase Fab1p, lipid phosphatase Fig4p, the Fab1p activator Vac7p, the Fab1p inhibitor Atg18p, and Vac14p, a protein required for the activity of both Fab1p and Fig4p. This domain appears to be the one responsible for binding to Fab1. The full length Vac14 in yeasts is likely to be a protein carrying a succession of HEAT repeats, most of which have now degenerated. This regulatory system is crucial for the proper functioning of the mammalian nervous system.
Statistics
?
PSSM-Id: 315434
View PSSM: pfam12755
Aligned: 33 rows
Threshold Bit Score: 129.213
Threshold Setting Gi: 124452248
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54HT3         64 NNKKGGLIGLASVAIGLGT------D------AYLYIQEIVPPVLRCFIDHDSRIRFYACESLFNIAKVTRSKILF--FF 129  Dictyostelium...
Q4UF45         78 NLRIGGLMAMACTALSLEK------Y------LLDFCEKFIKLVILSFYDQDNKVRYYSCEALYNIVKKCKVESIS--CI 143  Theileria ann...
A0EEU8         61 QYKKGGLHGLYSIAIDISK------Ket---iIKNCLNYIIDPMVDCMRDKEERVRYTAIEYLFLTSKQLGDYVLN--KL 129  Paramecium te...
Q4YRY3        176 SERCGGLISLAFISISLEN------K------IKYYFSEILKIIMSCVNDSDSKVRYYVCESLYNLCKVSKNIAFN--NI 241  Plasmodium be...
Q5A352         63 SAKMGAITALGSVSVALGS------Fa-----IAYFLEDIVKPIFSTFKDTDARVRYYACESLYNVAKIARGEILI--YF 129  Candida albicans
XP_002287142  506 DARKGGAVALAACAIGLKKanegrrD------VMECRDLILASVVHACQDHSQRVRYYATESLFNVTKVIPSLAVQ--HF 577  Thalassiosira...
XP_002176888  366 DARKGGVVALAACAIGLKK------AelqdsaAEECRDLILASVVHACQDHSQRVRYYATESLYNTVKAIPNLAVQ--HF 437  Phaeodactylum...
XP_001610290   79 EYRIGGMIGLASAAIALDA------H------LNRHGDTFIKLVLPYFTDQDST-------SLYNIIKKAKQASMR--CF 137  Babesia bovis...
KFG33186      148 NHRKGGLVALASVAIALEA------Q------VSPFLPFLLPPLLRAFSDPEPRVRYYACEALYNVLKVAQTSALP--FL 213  Toxoplasma go...
XP_002768353  391 NARKGGLLGLASVAIALEN------Rn-----LDPFLDTIMAPVLYLFDDDDNRCRYYACEAMFNISKVARGLLLKgrRM 459  Perkinsus mar...
Q54HT3        130 NEIFDVLCKLSSDLDPQVKGGVQLFDRLLKD 160  Dictyostelium discoideum AX4
Q4UF45        144 SEIFDGICKLTCDIDEDVKYASQILNRLLCD 174  Theileria annulata
A0EEU8        130 EDIYSYLVQSFLDPDESVRKAASQLDNCLKS 160  Paramecium tetraurelia
Q4YRY3        242 EEIFNCLYRIFSDTCPNVKTGGAFLDNLLKD 272  Plasmodium berghei
Q5A352        130 NDIFDILCILVSDSESSVKNAADILDRLVKD 160  Candida albicans
XP_002287142  578 FILFEILRSLYADVDLDVRSGAELLDKKLKE 608  Thalassiosira pseudonana CCMP1335
XP_002176888  438 FILYEILRSLYADVDGNVRGGAETLDKTLKQ 468  Phaeodactylum tricornutum CCAP 1055/1
XP_001610290  138 NDIFDGVCKLCCDEDEDVRQSSQFINRLLKE 168  Babesia bovis T2Bo
KFG33186      214 NDIFDGICKLYGDVDLDVRGGVVFVDRLLKE 244  Toxoplasma gondii GAB2-2007-GAL-DOM2
XP_002768353  460 CLALDGVCRLVADVDQEVKSGAQYLDRLLKD 490  Perkinsus marinus ATCC 50983
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap