Conserved Protein Domain Family
Vac14_Fab1_bd

?
pfam12755: Vac14_Fab1_bd 
Vacuolar 14 Fab1-binding region
Vac14 is a scaffold for the Fab1 kinase complex, a complex that allows for the dynamic interconversion of PI3P and PI(3,5)P2p (phosphoinositide phosphate (PIP) lipids, that are generated transiently on the cytoplasmic face of selected intracellular membranes). This interconversion is regulated by at least five proteins in yeast: the lipid kinase Fab1p, lipid phosphatase Fig4p, the Fab1p activator Vac7p, the Fab1p inhibitor Atg18p, and Vac14p, a protein required for the activity of both Fab1p and Fig4p. This domain appears to be the one responsible for binding to Fab1. The full length Vac14 in yeasts is likely to be a protein carrying a succession of HEAT repeats, most of which have now degenerated. This regulatory system is crucial for the proper functioning of the mammalian nervous system.
Statistics
?
PSSM-Id: 315434
View PSSM: pfam12755
Aligned: 33 rows
Threshold Bit Score: 129.213
Threshold Setting Gi: 124452248
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74852302    64 NNKKGGLIGLASVAIGLGT------D------AYLYIQEIVPPVLRCFIDHDSRIRFYACESLFNIAKVTRSKILF--FF 129
gi 74952664    78 NLRIGGLMAMACTALSLEK------Y------LLDFCEKFIKLVILSFYDQDNKVRYYSCEALYNIVKKCKVESIS--CI 143
gi 124452248   61 QYKKGGLHGLYSIAIDISK------Ket---iIKNCLNYIIDPMVDCMRDKEERVRYTAIEYLFLTSKQLGDYVLN--KL 129
gi 74988443   176 SERCGGLISLAFISISLEN------K------IKYYFSEILKIIMSCVNDSDSKVRYYVCESLYNLCKVSKNIAFN--NI 241
gi 74585773    63 SAKMGAITALGSVSVALGS------Fa-----IAYFLEDIVKPIFSTFKDTDARVRYYACESLYNVAKIARGEILI--YF 129
gi 223994917  506 DARKGGAVALAACAIGLKKanegrrD------VMECRDLILASVVHACQDHSQRVRYYATESLFNVTKVIPSLAVQ--HF 577
gi 219110273  366 DARKGGVVALAACAIGLKK------AelqdsaAEECRDLILASVVHACQDHSQRVRYYATESLYNTVKAIPNLAVQ--HF 437
gi 156085761   79 EYRIGGMIGLASAAIALDA------H------LNRHGDTFIKLVLPYFTDQDST-------SLYNIIKKAKQASMR--CF 137
gi 672258116  148 NHRKGGLVALASVAIALEA------Q------VSPFLPFLLPPLLRAFSDPEPRVRYYACEALYNVLKVAQTSALP--FL 213
gi 294878350  391 NARKGGLLGLASVAIALEN------Rn-----LDPFLDTIMAPVLYLFDDDDNRCRYYACEAMFNISKVARGLLLKgrRM 459
                          90       100       110
                  ....*....|....*....|....*....|.
gi 74852302   130 NEIFDVLCKLSSDLDPQVKGGVQLFDRLLKD 160
gi 74952664   144 SEIFDGICKLTCDIDEDVKYASQILNRLLCD 174
gi 124452248  130 EDIYSYLVQSFLDPDESVRKAASQLDNCLKS 160
gi 74988443   242 EEIFNCLYRIFSDTCPNVKTGGAFLDNLLKD 272
gi 74585773   130 NDIFDILCILVSDSESSVKNAADILDRLVKD 160
gi 223994917  578 FILFEILRSLYADVDLDVRSGAELLDKKLKE 608
gi 219110273  438 FILYEILRSLYADVDGNVRGGAETLDKTLKQ 468
gi 156085761  138 NDIFDGVCKLCCDEDEDVRQSSQFINRLLKE 168
gi 672258116  214 NDIFDGICKLYGDVDLDVRGGVVFVDRLLKE 244
gi 294878350  460 CLALDGVCRLVADVDQEVKSGAQYLDRLLKD 490
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap