3PA6,4BU0


Conserved Protein Domain Family
PTCB-BRCT

?
pfam12738: PTCB-BRCT 
Click on image for an interactive view with Cn3D
twin BRCT domain
This is a BRCT domain that appears in duplicate in most member sequences. BRCT domains are peptide- and phosphopeptide-binding modules. BRCT domains are present in a number of proteins involved in DNA checkpoint controls and DNA repair.
Statistics
?
PSSM-Id: 315420
View PSSM: pfam12738
Aligned: 42 rows
Threshold Bit Score: 66.8266
Threshold Setting Gi: 313754541
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3PA6_A         11 VVAYVEVWSSNGtenySKTFTTQLVDXGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLW 77   human
Q07139        179 LVLCFTGFRKKEe---LVKLVTLVHHMGGVIRKECNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEW 242  house mouse
Q5TRD6         97 VITCFTGIRKKDe---LTHLVHLIHSMGGSIRKGMDTKVTHLICNSSGGEKYRYAMTFRLAIIRPNW 160  Anopheles gambiae str. PEST
Q9U7D8        117 VVTCFTGIRKKDe---LTKLVNLIHSMGGCIKKDLNTKTTHLICNHSGGEKYQYAKTFRLTVVRPAW 180  fruit fly
Q16W28        219 VCIYVEVRSGTDn--rSDGIRDHLVSLGAKVNDKLYKDTTHVIFKDGLLSTYQKAKKMNVPVVSILW 283  yellow fever mosquito
Q7JUM5        187 IVVYVEVRTGNDn--rSEGVKSIIAKMGAQVKDRLTRTTTHVVFKDGLLSTYKKATEWNIPVVSILW 251  fruit fly
XP_002026022  186 VVVYVDVRSGNDn--rSDGVKSIIADMGAQINDRLLRNTTHVIFKDGLLSTYKKAVEWKIPVVSVLW 250  Drosophila persimilis
XP_002004480   96 VIVYVEVRTGNDn--rSEGVKNIITKLGAQANDRLLRNTTHVVFKDGLLSTYKRAQSWNIPIVSILW 160  Drosophila mojavensis
XP_003302421  171 ITITPGHMPASL----RESLQRSVERIGAKISDNVRIDTTHFVCTEGRGPSWEKAVENNIPVVVPDW 233  Pyrenophora teres f. teres...
XP_001885295  502 VRMSLSGLDEAD----AHGIKRLMRAIGLVIPPVFSKKATHLLCPSGTGLKFDKAQEWGIPVVSIGW 564  Laccaria bicolor S238N-H82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap