Conserved Protein Domain Family
DUF3810

?
pfam12725: DUF3810 
Protein of unknown function (DUF3810)
This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 333 and 377 amino acids in length. There is a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterized family of peptidase enzymes.
Statistics
?
Aligned: 134 rows
Threshold Bit Score: 205.477
Threshold Setting Gi: 297164709
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Clos_1008             41 YSSTLNKWTIQLVSKITGIFPFSLAEILYvghLIAIPVVAAVFIYKL------LKGGAFQFLYK----VATYLCILYIVF 110 Alk...
bowmanTIA:P700755_003393  34 YSQSFFVYISQLQHFLTSWIPFSIGDLFY---SAMVLIILGWLIKLIrrk--------tksLKTmlleAFAFVSLIYFLF 102 Psy...
jgi:Phep_3230             36 YSEGFYSLTSVIQRFISGIFPFALGDFLY---LLLILYTARSLYRFYkk--iiQKRLQQSDRLHvplqVLNFTLVLYLLF 110 Ped...
jgi:Solca_2244            36 YANGIYKLISILQRSITGWLPFSLGDVVY---AVVILLILLGIFQYIrgivkaKEN-RGSFALNgllkGTIIFLCAYLVF 111 Sol...
jgi:Cpin_6294             38 YFHRLYVWISLLLRKVLGKVPFSIGDVIY---AAWIITSVIYLLKICykilkkQWKLLGIQFLQgi----qALLSVYLIF 110 Chi...
jgi:Niako_0427            32 YASGFYPVISKLQRILLGWLPISVGDIFY---ALVIVWLINRLYKTIrr--vaKKQTNKKYWLQalaqLGFIVLVVYVSF 106 Nia...
PRJNA61269:NIASO_09870    33 YTQGFYSGVSKSLRFLFGWLPFSIGDVLY---TGLIILVIVLLARVIkr--llKGKLRSIRWGKhlnnTLLAMLGLYIIF 107 Nia...
jgi:Ornrh_1282            37 lfTQWYRFFYPIYTKVFGWVAFSVGDFMYlfvALFLIQFIYFLIKSL--------VQKNGNRAHffnkIFWLIGIMYASF 108 Orn...
jgi:Weevi_1763            36 YNVTIYPKINHLLLSIFSRISIPIGEIFY---LLLGASLLFFLYRFSy----tLVKKKYCETKNtlvyILLIGNTFFGFF 108 Wee...
FLIJena:FIC_02124         37 ataHFFEVQKATHQKFTAGVPFSLGDVFY---ILLIVLLIIFLYKIF----------KKSSRNAallsALIFINVLHFVY 103 Fla...
jgi:Clos_1008            111 MGMWGLNYSRMSVGTMLnlkVTTYS-EEELYELTEALVEKANELRE--NI------------IENP----EGVVTLKggy 171 Alk...
bowmanTIA:P700755_003393 103 HVFWGFNYYRLPLHDSLg-iSTEYN-KADLLEYICDLIQQTNTLHS--QL------------VSEDslkvdy----dftq 162 Psy...
jgi:Phep_3230            111 KGLWGLNYSRIPIARQLgisNEKYN-TEELVLLGKYFIARLNNLQHlkRAayt--------------------------t 163 Ped...
jgi:Solca_2244           112 QFCWGLNYFRQPLSERLmlnSERAD-KEQLMRLAAILTQRVNTAHL--EL------------TNDSlvqyrn----pihs 172 Sol...
jgi:Cpin_6294            111 MLFWGYNYDRNSLESDLsleVNEYN-ADQLYRLTDTLLQQVNQYKS--AL------------GDTVhathpg-----ads 170 Chi...
jgi:Niako_0427           107 NLLWGLNYNRRGVAYQLglkVERYS-KDDLVQVMRQVVSRLNALDSlsRV------------NREAllr----------k 163 Nia...
PRJNA61269:NIASO_09870   108 YALWGLNYSRPGIEKQFglnVAHIT-VKDLDTLVQTLHARINRDAAamTV------------RDRDsllnTRF------- 167 Nia...
jgi:Ornrh_1282           109 HFLWAFNYYKKPIFDDF-----KPAnTQELKNIADDLFAKAKAQGQwvQRapsgemlf-----------------apqaf 166 Orn...
jgi:Weevi_1763           109 QLFWGINYAKKSFTSDF---YIDDVsIDELKSIAENELTLVKFYRN--QVqenengifilqeDQKT-------------- 169 Wee...
FLIJena:FIC_02124        104 QLYWGMLYYQKPILETL---SREEItVQETQSLALKYLELCKKSRA--QV------------REDQ----NGVFKISdl- 161 Fla...
jgi:Clos_1008            172 rdVLTRADEGYKILGKS-------IGVF-SGN-YGK--AKPILLSKPMLYTGITGMYFPFTSEANVNIATHDLLLPATVL 240 Alk...
bowmanTIA:P700755_003393 163 keVQDLVFKAYQNTDNT-------DLKI-SYR-IEN--LKPSLFSLPLSYAGFSGYVNPFTNEAQYNYKIPTYKFPTTMA 231 Psy...
jgi:Phep_3230            164 aqLEAEAKQAYDKMRRK-------NAFF-NYR-SPA--VKPVLNSWVVTKIGIEGYYNPLSGEANINMRLPETSLPFVSC 232 Ped...
jgi:Solca_2244           173 dsLYKIASVGYDK-----------SVDF-NFK-IRS--TKTSLYKLLMNYGGIGGYYNPFSGESQVNTDPPKFSLPFTIC 237 Sol...
jgi:Cpin_6294            171 aaMFSQAINAYEAAVEK-------WPGL-RYN-SPC--IKPSLYGHWINYMGVGGYLNPFTGEAHVNVTTPGFLQPFTIC 239 Chi...
jgi:Niako_0427           164 rnLFNGATSAYDQLARN-------EPHF-TYS-FSS--VKPSLYSYLGNYLGYTGYYNPFSGEAQVNTTVPLFVQPFTTC 232 Nia...
PRJNA61269:NIASO_09870   168 --LFKQSNVAYRVAKKE-------YPFL-NNT-PVS--VKPSLFSEAMNYIGIQGYYNPFSGEAQVNTTIPVFLLPSVVT 234 Nia...
jgi:Ornrh_1282           167 nyLIQDSIQPVQGLNLP-------FRKF------PKqrKKNSIYSFAMRYMGVSGYYNPFTAEAQITQGLPSVSQPFTMA 233 Orn...
jgi:Weevi_1763           170 --LQENILSDQQQLVY--------FPFLkSKYvIDKnnFKPSFFSSLANYLGVLGYYNPFTNEANYNNKTTDLSRPFTLA 239 Wee...
FLIJena:FIC_02124        162 seVKTQILQNQHQLPTFavprkgtNTDV----------FKPSLFRGLMSYSGILGYYNPFTAEAQYNAELPATYLPFTLA 231 Fla...
jgi:Clos_1008            241 HEIAHQRGFASEDEANYIAYLSASAHPDWDFKYSGTMLALIHSMKALSKQNAQL-ASELTRNYSEGLKRDIHNYNEFWKN 319 Alk...
bowmanTIA:P700755_003393 232 HEIGHQLGFSKENEANFIASIITMEDSNKFLRYSGLTFALKYSLNDMYKKDPVL-SGVLISDLHPGILKNYQEVQNFWEA 310 Psy...
jgi:Phep_3230            233 HEIAHQLGVAREDEANLVGYLVAINSENPDFRYSAAYNMLKSILFEIRIKSAED-YEALYKTINPLTLKDIQNDRDFWQK 311 Ped...
jgi:Solca_2244           238 HEMAHQSGISAEEEANFVGYITALNTQDKFFKYSAELEAFMYTVSELGRMDTLA-RKHYYLSLNRGVKADIKEYRQFWRK 316 Sol...
jgi:Cpin_6294            240 HEVAHQLGYAPEEEANFVGYLVAGNSPDIHFRYAANFEMFMYSVRQLRRQDTTL-AGELWRKAVPGIRADMRQIRDFYDQ 318 Chi...
jgi:Niako_0427           233 HEIGHQLGYARENEANFAGYLSARSSQDPLFRYSVYFDLYSYSRFYLYAQDSVT-ARQLDAELSPGIKTDYHELREFVKK 311 Nia...
PRJNA61269:NIASO_09870   235 HEIGHQVGYAKESEANFMSFLTSRKHPSIHFQYSTDFVMYLYAASELYRLDSVK-VKQYDSTLHPQVKKDIKTYIGFYKK 313 Nia...
jgi:Ornrh_1282           234 HEQAHQMGYAFESEANFVGYLACVQSPSPALRYAANYKALRYVLRAIYPKDSMFvKEKIRAY-SPGMQADYQAELDYFNK 312 Orn...
jgi:Weevi_1763           240 HELAHLISYAPENEANFIAYLIAEQSKSIDLLYSAHYKTLMNALRNIAYKDPEY-VKNILDNFSDGMVRDREHERWHAEK 318 Wee...
FLIJena:FIC_02124        232 HESAHQLGYAREQEANFIGYLIGKNSGNADLRYSTQYAVLKSLLNALSEKTPGF-VENAIRLYSPAMQRDREAEKLFVQQ 310 Fla...
jgi:Clos_1008            320 YegNVNK-TADKVNDLYLKVNGKVEGTKSYGKMVDLLL 356 Alkaliphilus oremlandii OhILAs
bowmanTIA:P700755_003393 311 YsgPVEL-IMEKIYGNYLKVNNQPQGIESYSYVVALLV 347 Psychroflexus torquis ATCC 700755
jgi:Phep_3230            312 YnsDMYM-YFGLAFDRFLKLNNQPKGTDSYQDIVLWLY 348 Pedobacter heparinus DSM 2366
jgi:Solca_2244           317 YenAIEP-YFEWYYDLFLKSNNQPKGIRSYNEFVNLLV 353 Solitalea canadensis DSM 3403
jgi:Cpin_6294            319 YrsPVDD-YTAMIYDQYLKANNQEKGIRSYSEVVGWLI 355 Chitinophaga pinensis DSM 2588
jgi:Niako_0427           312 YrnPMEE-VIDHLYGQYLKANNQPGGKLTYNEVVAWLV 348 Niastella koreensis GR20-10
PRJNA61269:NIASO_09870   314 YqnRIEP-VIHWLYGNYLRANNQPSGNRSYDEVVIWLI 350 Niabella soli DSM 19437
jgi:Ornrh_1282           313 Yn-SVADkVFSAMNHQYLKANNQEEGLASYGKFVSLLV 349 Ornithobacterium rhinotracheale DSM 15997
jgi:Weevi_1763           319 Ylg-aASdAFSNLNDVYLRANNQ-EGISSYSQYIvyva 354 Weeksella virosa DSM 16922
FLIJena:FIC_02124        311 HqgVLDV-FFGYTNDLFLKSNRQ-EGSVTYSYFVDLLV 346 Flavobacteriaceae bacterium 3519-10
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap