2W49


Conserved Protein Domain Family
Tropomyosin_1

?
pfam12718: Tropomyosin_1 
Click on image for an interactive view with Cn3D
Tropomyosin like
This family is a set of eukaryotic tropomyosins. Within the yeast Tpm1 and Tpm2, biochemical and sequence analyses indicate that Tpm2p spans four actin monomers along a filament, whereas Tpm1p spans five. Despite its shorter length, Tpm2p can compete with Tpm1p for binding to F-actin. Over-expression of Tpm2p in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1p. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis. The family also contains higher eukaryote Tpm3 members.
Statistics
?
Aligned: 25 rows
Threshold Bit Score: 87.3678
Threshold Setting Gi: 530774822
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2W49_A                1 MQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEadvaS 80  rabbit
EEQ34549              8 IESMRLEIDDGQTKLSEQKARIKELEQENLAKEQEVTSLTHRNQLLEERVENLEATLKEAKAKASEAAQDSSQNE----A 83  Microspo...
EAW11835             17 MSALRLEADEAQNKVEELKSKVKTLEQENLAKEQEITSLNHRNQLLEGEVEKLETTLKEAKESANQSAQHDTQNE----A 92  Aspergil...
CAP95349              8 MVSLRAEADEAHELVDELKAKVKTLEQENLSKEQEITSLNHRNQLLEEEVEKAEAALKEAKDAASQSLQHDTQNE----A 83  Penicill...
WGS:AATM:SJAG_04887   8 LNSIRAEAEEALARAEAAEESLKEKEHELARKDQELASLHKKNEDLEEQVDQLEQELKDVKEQAESESNQQSLID----S 83  Schizosa...
EDP45051              8 LNSLRAEADAALERAEVAEARNKELEQDNLSKEQEISSLQHKLSVLESDLENAEAKLSEAKVGKEEGESHKSNVD----I 83  Malassez...
EDR14060             11 LNSLRTEADNAVLRAEEAEAKNKKYEQLLLEKEQEITSLQHKLSQLDAELEKAEEKVAEYKTANVDGEQTKMTSE----G 86  Laccaria...
Q5KF76               11 LGQ-KIEAAEA--RAEAAESENKKLNQTLLERDQELASLQHKLQLAEEELEASESKVKELKAASDEGETHRTTGE----N 83  Cryptoco...
XP_006511103          8 MQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEadvaS 87  house mouse
Q17H75                8 MQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAKLEEKEKALQNAEsevaA 87  yellow f...
2W49_A               81 LNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 145 rabbit
EEQ34549             84 LQRRIQLMEEEAEQTDKTLRETNEKLRQTDVKAGHFERKVQALEATREQWETKYEEMSKQYAAVK 148 Microsporum canis CBS 1...
EAW11835             93 LQRRVQLLEEEAEEADRNLRETNEKLRQTDVKAGHYERKVQALEASRDQWESKYEEMAKKYAELQ 157 Aspergillus clavatus NR...
CAP95349             84 LQRRVQLLEEEAEENDKTLRETNEKLRQTDIKAGHYERKVQALEDQHAKLEQRYEDAIKEHSAVK 148 Penicillium rubens Wisc...
WGS:AATM:SJAG_04887  84 LNRKIESLEEELENSDKSLRETTEKLRQIDINTEHTERKIQALEHERDDLEVRLEDTTDKYNKVK 148 Schizosaccharomyces jap...
EDP45051             84 LQRRIDMLEEQLDQSERSLKETTEQLRHTDVRAEQLERQIQGAEQERDQWEHKYEEAQERYQASK 148 Malassezia globosa CBS ...
EDR14060             87 LQRKVQLLEEELDVAEKNVKETVERLRQVDVKAEHFERQVQRLEQERDLWEKKYEESEAKYKKSQ 151 Laccaria bicolor S238N-H82
Q5KF76               84 LARKVQLLEEELDKAEKDLKETTEKLRQVDVKAEHFERQVQRLEQERDEWERKHGEAVEKYQQSK 148 Cryptococcus neoformans
XP_006511103         88 LNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152 house mouse
Q17H75               88 LNRRIQLLEEDLERSEERLASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKEAR 152 yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap