Conserved Protein Domain Family
Tropomyosin_1

?
pfam12718: Tropomyosin_1 
Click on image for an interactive view with Cn3D
Tropomyosin like
This family is a set of eukaryotic tropomyosins. Within the yeast Tmp1 and Tmp2, biochemical and sequence analyses indicate that Tpm2p spans four actin monomers along a filament, whereas Tpmlp spans five. Despite its shorter length, Tpm2p can compete with Tpm1p for binding to F-actin. Over-expression of Tpm2p in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1p. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis. The family also contains higher eukaryote Tmp3 members.
Statistics
?
PSSM-Id: 315401
View PSSM: pfam12718
Aligned: 26 rows
Threshold Bit Score: 86.5817
Threshold Setting Gi: 745752380
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam12718 is a member of the superfamily cl26315.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2TMA_A         7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAE---- 82
gi 74684576   10 ILGQ-KIEAAEA--RAEAAESENKKLNQTLLERDQELASLQHKLQLAEEELEASESKVKELKAASDEGETHRTTGE---- 82
gi 122118417   7 KMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAKLEEKEKALQNAEseva 86
gi 830074079   7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAE---- 82
gi 164662287   7 KLNSLRAEADAALERAEVAEARNKELEQDNLSKEQEISSLQHKLSVLESDLENAEAKLSEAKVGKEEGESHKSNVD---- 82
gi 745752380   7 KLNSIRAEAEEALARAEAAEESLKEKEHELARKDQELASLHKKNEDLEEQVDQLEQELKDVKEQAESESNQQSLID---- 82
gi 260821720   7 KMLMLKNDKENALDRAEQAEQAMKDAQEKNVKLEDEINDLNKKIRMVEDELDKAQESLKDATEQLEAATKKAADAEaeva 86
gi 393908625   7 KMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSVANTNLEEKEKKVQEAEaeva 86
gi 170086792  10 KLNSLRTEADNAVLRAEEAEAKNKKYEQLLLEKEQEITSLQHKLSQLDAELEKAEEKVAEYKTANVDGEQTKMTSE---- 85
gi 171692909   7 KMTQLRLESEESAAKVEELQAKVKALEQENLQKEQEIISLTHKNSVLESEVEKYETQVKDLKSAASEGAQHGTQNE---- 82
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2TMA_A        83 AdvasLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152
gi 74684576   83 N----LARKVQLLEEELDKAEKDLKETTEKLRQVDVKAEHFERQVQRLEQERDEWERKHGEAVEKYQQSK 148
gi 122118417  87 A----LNRRIQLLEEDLERSEERLASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKEAR 152
gi 830074079  83 AdvasLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152
gi 164662287  83 I----LQRRIDMLEEQLDQSERSLKETTEQLRHTDVRAEQLERQIQGAEQERDQWEHKYEEAQERYQASK 148
gi 745752380  83 S----LNRKIESLEEELENSDKSLRETTEKLRQIDINTEHTERKIQALEHERDDLEVRLEDTTDKYNKVK 148
gi 260821720  87 S----LNRRIQLVEEELDRAQERLNSTVEKLTDSEKAADESERARKVLENRGAADEDRMELLDMQLREAK 152
gi 393908625  87 A----LNRRMTLLEEELERAEERLKIATDKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEAQ 152
gi 170086792  86 G----LQRKVQLLEEELDVAEKNVKETVERLRQVDVKAEHFERQVQRLEQERDLWEKKYEESEAKYKKSQ 151
gi 171692909  83 T----LTRRLQLLEEEAEQADKTLREANEKLRQTDVKAGHFERKVQALEQERDQWESKYEEMAKKYATVQ 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap