3NUZ,3G8Y


Conserved Protein Domain Family
Abhydrolase_7

?
pfam12715: Abhydrolase_7 
Click on image for an interactive view with Cn3D
Abhydrolase family
This is a family of probable bacterial abhydrolases.
Statistics
?
PSSM-Id: 372264
View PSSM: pfam12715
Aligned: 11 rows
Threshold Bit Score: 735.768
Threshold Setting Gi: 187425936
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NUZ_A           6 GWSPKDHNLIKSVREDGRFLSSYGVVHAXLRNTEPRYAFHRDFSPKEFRKWQKGLRHAXEEIXKFPQIKNSPAPVCIKRE 85  Bacteroides f...
Q5LEF1          24 GWSPKDHNLIKSVREDGRFLSSYGVVHAMLRNTEPRYAFHRDFSPKEFRKWQKGLRHAMEEIMKFPQIKNSPAPVCIKRE 103 Bacteroides f...
jgi:Bache_2785  23 DFQPDRYRVVTTDRSDGRFISTYGIVHQMLKDMKPKYAFNPAFTQNDFLGWQKDVSLAMAEIMCHPQSEKPCTFICVGHE 102 Bacteroides h...
wustl:BV4006    24 NYQPEKHAVVKSDRGDGRLLSTYAIVHEMLKDTHPQYAYRSGMSAQEFTQWQDGVRAAMVEIMKFPEIKRQPSPVCVKTE 103 Bacteroides v...
WP_008143900    23 NWDPEQHAVIVSERGDGRFTSSYAIVHQLVKNTRPSLSFHSEMRPEEMPVWQSEVRQAMMKLMAFPDYLPEKKPICVSQE 102 Bacteroides c...
jgi:Amuc_1391   29 KFRAADWAVLHSSRSDQRHVSSRGIVQTMLEKLRPACEFSPDMAPKDFPAWREKVRKAMQQLMKFPPQADIPAPVLVKTV 108 Akkermansia m...
WP_005941771    22 AFSPEQHKTVCSERSDGRYLSTYGVVHAMLKDTKPLYAFRHDFTRQEFAEWQKEVRTAMIEIMHHPHITGQPIPVCIEKI 101 Bacteroides
CDE58613        22 SFQPEEHATFQTNRTDGRYVSSRAVAHQLMKELEPAFSFRPSMQAADFKTWQKHVRLQMERLMKHPQLQNLPKPVCIRTE 101 Parabacteroid...
3G8Y_A           1 GYQPEKHAVVKSDRGDGRLLSTYAIVHEXLKDTHPQYAYRSGXSAQEFTQWQDGVRAAXVEIXKFPEIKRQPSPVCVKTE 80  Bacteroides v...
CDA74689        14 tvsqdSASRITTNRQDGRFLSTRGTVQYMLKNVQPAYAFNPSFTPAEFKKWQSGLRDTMKELMRFPQQAAVQAPVCVKTV 93  Bacteroides s...
CDA84920        25 dvtgSGHNIIQTDRSDGRFLSTYGVVHAMLSGIKPECAFQPDMTAEEFREWQHKVRKSMQEIMKFPEVKDMPFPKRLYSK 104 Bacteroides s...
3NUZ_A          86 QREGYRLEKWEFYPLPKCVSTFLVLIPDNI--NKPVPAILCIPGSGGNKEGLAGEp--gIAPKLNDRYKDP--KLTQALN 159 Bacteroides f...
Q5LEF1         104 QREGYRLEKWEFYPLPKCVSTFLVLIPDNI--NKPVPAILCIPGSGGNKEGLAGEp--gIAPKLNDRYKDP--KLTQALN 177 Bacteroides f...
jgi:Bache_2785 103 QKDGYKEEKWEFYPLPSCVSTFYVLIPDNV--RQSSPAVLCIPGSGMTKEHLIGRi--sSQNM----------RAAMALN 168 Bacteroides h...
wustl:BV4006   104 KKEGYILEKWEFYPFPKSVSTFLVLKPEHL--KGAVPGVLCIPGSGRTKEGLVGEp--gICDKLTEDYNNP--KVSMALN 177 Bacteroides v...
WP_008143900   103 KRDGYTLEKWEFYPLPQALSTFLVLRPNHL--SKTVPAVLCIPGSGMSKEGLAGEp--gISEKLNDNYTSE--KVSMALN 176 Bacteroides c...
jgi:Amuc_1391  109 PREHYRVEKWEAYPFPGAAVPFLVLLPDNAsdKNPVPVLFCIPGSDQTKEELAGE----TSPDLDQPSVQQpgNNAMAFH 184 Akkermansia m...
WP_005941771   102 QKDGYRQEKWEFYPLPHCVSTFYILIPDKV--KIPGPAVLCIPGSGMTKENLIGEv--sANNM----------RAAMALN 167 Bacteroides
CDE58613       102 QRDGYRLEKWEAYPLPACVVPFLVLIPDNLdeKHPSPAVLCIPGWGGTKEELAGEpqlyVPDKPTQES-----KNSMAYQ 176 Parabacteroid...
3G8Y_A          81 KKEGYILEKWEFYPFPKSVSTFLVLKPEHL--KGAVPGVLCIPGSGRTKEGLVGEp--gICDKLTEDYNNP--KVSXALN 154 Bacteroides v...
CDA74689        94 QRGGYRVEKWESYPQQGSVVPFLVLIPDGVdaKHKVSAVLCIPGFGGSKEGLAGEn--eGDYELTLSPKEPvkKGAMALH 171 Bacteroides s...
CDA84920       105 QRDGYKLEKWEFYPLPECVSTFLVLIPDSL--RQPVPAILCIPGSGGSKEGLAGEp--gVAPKLNDDYLNP--KVTMARN 178 Bacteroides s...
3NUZ_A         160 FVKE---------GYIAVAVDNPAAGEASDLERYTLGSNYDYDVVSRYLLELGWSYLGYASYLDXQVLNWXKTQKHIRKD 230 Bacteroides f...
Q5LEF1         178 FVKE---------GYIAVAVDNPAAGEASDLERYTLGSNYDYDVVSRYLLELGWSYLGYASYLDMQVLNWMKTQKHIRKD 248 Bacteroides f...
jgi:Bache_2785 169 VAKQ---------GYIAVAVDNAAAGEAADLEHLS-QVGYDYDTPSRILLELGWSYLGYTSYLDKQVLDWMKRQSMIRKD 238 Bacteroides h...
wustl:BV4006   178 MVKE---------GYVAVAVDNAAAGEASDLECYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDMQVLNWMKAQSYIRKD 248 Bacteroides v...
WP_008143900   177 FVRK---------GYIAVAVDNPASGEASDLEMYTRGRQYDYEVVSRMLLEIGWSYLGYTSWLDMQVLDWMKQDPDIRKD 247 Bacteroides c...
jgi:Amuc_1391  185 YVRQ---------GWAAIVVDNAGTGEEGDAEHAAGRSSHDYENLARFLLEMDWSWLGYTSYADQCILDWVKTRPWAQKN 255 Akkermansia m...
WP_005941771   168 IAKQ---------GYISVAVDNAAAGEAADLEPLT-GTSYDYDTPSRILLELGWSYLGYTSFLNKQVLEWMKCQPFIRKD 237 Bacteroides
CDE58613       177 YVKA---------GLIAVAVDNPGSGELADLETEAKSYAYDFQTFARSLLELGWNYLGYSSYTNQHILNWMKHHPLMRKD 247 Parabacteroid...
3G8Y_A         155 XVKE---------GYVAVAVDNAAAGEASDLECYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDXQVLNWXKAQSYIRKD 225 Bacteroides v...
CDA74689       172 YVKK---------GLVAVAVDNPSCAELSD------NGHFDYLVTSRFLLEMGWSYLGLTAYQDWNVLNWMKTQNYVRKD 236 Bacteroides s...
CDA84920       179 FAKAgyvavavxxGYVAVAVDNPAAGEASDLERYARGRNYNYDLVSRILLELGWNYLGYTSFLDMQVLQWMKTQSYIRKD 258 Bacteroides s...
3NUZ_A         231 RIVVSGFSLGTEPXXVLGTLDTSIYAFVYNDFLCQTQERAEVXTXPDKNGRRPFPNSIRHLIPDFWKNFNFPDIVAALAP 310 Bacteroides f...
Q5LEF1         249 RIVVSGFSLGTEPMMVLGTLDTSIYAFVYNDFLCQTQERAEVMTMPDKNGRRPFPNSIRHLIPDFWKNFNFPDIVAALAP 328 Bacteroides f...
jgi:Bache_2785 239 RIVVSGFSLGTEPLMVLGALDPDIYGFVYNDFLCQTQERAIVMTAPDENGRRPFPNSIRHLIPNFWRYFNFPDIVASLAP 318 Bacteroides h...
wustl:BV4006   249 RIVISGFSLGTEPMMVLGVLDKDIYAFVYNDFLCQTQERAVVMTKPDKENRRPFPNSIRHLIPGYWRYFNFPDVVASLAP 328 Bacteroides v...
WP_008143900   248 RIIVSGFSLGTEPLMVLGVLDPSIYAFVYNDFLCQTQERAIVMTKPTEKGYRPFPNSIRHLIPGFWHYFNFPDLVAALAP 327 Bacteroides c...
jgi:Amuc_1391  256 HIILSGFSLGTEPMMVLGSLNPDIFAFVYNDFLCRTLERAKTMTMPNGRGVRSAPNSIRHLIPGFWKQFDFPDIVAALAP 335 Akkermansia m...
WP_005941771   238 RIVVSGFSLGTEPLMVLGVMDPSIYAFIYNDFLCQTQERAIVMTEPDQRGRRPFPNSIRHLIPDFWKYFNFPDIVASLAP 317 Bacteroides
CDE58613       248 RLIVSGFSFGTEPLMALGNMDESIYAFVYNDFLCRTRERDLVLTMPDEKGRRGWPNDISHLIPAFLCNFDFPDLVAALAP 327 Parabacteroid...
3G8Y_A         226 RIVISGFSLGTEPXXVLGVLDKDIYAFVYNDFLCQTQERAVVXTKPDKENRRPFPNSIRHLIPGYWRYFNFPDVVASLAP 305 Bacteroides v...
CDA74689       237 RIIVSGFSLGTEALMVLGALDPSIYAFVYNDFLCRTLERILVMSKPDDKGVRHFPNSIEHLIPGFLTQFDFPDLVAALAP 316 Bacteroides s...
CDA84920       259 RIIVSGFSMGTEPLMVLGTLDTSIYAFVYNDFLCHTQERALVMTAPDKTGIRPFPNSIRHLIPDFWRKFNFPDIVASLAP 338 Bacteroides s...
3NUZ_A         311 RPIILTEGGLDRDLDLVRKAYAIVGTPDNVKIYHYKKFSDPDTRKNVEYLPEGLDRNEYFRXVNVDGPNHYFKSELVVPW 390 Bacteroides f...
Q5LEF1         329 RPIILTEGGLDRDLDLVRKAYAIVGTPDNVKIYHYKKFSDPDTRKNVEYLPEGLDRNEYFRMVNVDGPNHYFKSELVVPW 408 Bacteroides f...
jgi:Bache_2785 319 RPLILTEGGLDRDLDLVRRAYEISEHPENVEIHHYAKFQMEEARNKMDKLPEGMDRNSYYISVNVDGVNHYFKNEYVLPW 398 Bacteroides h...
wustl:BV4006   329 RPIIFTEGGLDRDFRLVQSAYAASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYFKNELVIPW 408 Bacteroides v...
WP_008143900   328 RPLILTEGGLDRDLELVRKAYSLSGHPENVEIHHYEKYADPALRHFVSVLPEGLDRDTYFQMVNVDGTNHYFKNEFIFKW 407 Bacteroides c...
jgi:Amuc_1391  336 RPVICTEGGLDRDFQLISAAYRMAGAPDHFQYHHQPRFADPAQRWHGSQLPAGLDRDAFFRFANVDPRNHFFKKDLVIPW 415 Akkermansia m...
WP_005941771   318 RPIILTEGGLDRDFNLVKRAYEISGHPENVETHHYQKYTAPETRNTAQNLPEGLGRASFYDSVNVDGPNHYFKNEFVLPW 397 Bacteroides
CDE58613       328 RPVICTEGGLDRDLNLVKRAYELAGHPENFTFYHYKALQDSTKRKNLMTLPEGLDGETYFKLVNVQPENHYFKSEYIIPW 407 Parabacteroid...
3G8Y_A         306 RPIIFTEGGLDRDFRLVQSAYAASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYFKNELVIPW 385 Bacteroides v...
CDA74689       317 RPVICTEGGIDRDFDLISKAYKIAGKPDNFTYYHYKKYADPKDRKQIDKVPEGVDLATYFDYANVDPKNHYFKKEWVIPW 396 Bacteroides s...
CDA84920       339 RPVILTEGGLDRDLDLVRAAYKMTGRLENVEIHHYPKYADPHSRTDIKALPEGLDRNEFYKLVNVDGANHYFKSELILPW 418 Bacteroides s...
3NUZ_A         391 LRK 393 Bacteroides fragilis NCTC 9343
Q5LEF1         409 LRK 411 Bacteroides fragilis NCTC 9343
jgi:Bache_2785 399 LER 401 Bacteroides helcogenes P 36-108
wustl:BV4006   409 LRK 411 Bacteroides vulgatus ATCC 8482
WP_008143900   408 LDQ 410 Bacteroides coprophilus
jgi:Amuc_1391  416 LKT 418 Akkermansia muciniphila ATCC BAA-835
WP_005941771   398 LDK 400 Bacteroides
CDE58613       408 IKE 410 Parabacteroides sp. CAG:409
3G8Y_A         386 LRK 388 Bacteroides vulgatus ATCC 8482
CDA74689       397 LEK 399 Bacteroides sp. CAG:530
CDA84920       419 LKK 421 Bacteroides sp. CAG:754
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap