3ISY


Conserved Protein Domain Family
BsuPI

?
pfam12690: BsuPI 
Click on image for an interactive view with Cn3D
Intracellular proteinase inhibitor
This is a bacterial domain which has been named BsuPI in Bacillus subtilis. This domain is found in Bacillus subtilis ipi, where it has been suggested to regulate the major intracellular proteinase (ISP-1) activity in vivo. The structure of proteins in this family adopt a beta barrel topology.
Statistics
?
PSSM-Id: 338448
View PSSM: pfam12690
Aligned: 49 rows
Threshold Bit Score: 79.5743
Threshold Setting Gi: 501538341
Created: 31-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ISY_A        20 IKFNXSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKXFTQAFQNLTLESGETYDFSDVWKEVp-EPGTYE 96  Bacillus subtilis
P39804        19 IKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETYDFSDVWKEVp-EPGTYE 95  Bacillus subtilis...
Q9K8T7        62 IEATITLINTTDQDVHFQFSSGQQYELILKNEAGDTVYRYSDDKMFTMALIDETLAAGESKTWTESipagdleSGTYT 139 Bacillus halodurans
WP_034663358  51 VQFNMSLKNESDRDIEFTFNTSQKFELSVYDENGNEQYRYSKDRMFTQAIQSFVLKKGEAYDFQDTWSNGv-KPGTYE 127 Bacillus pumilus
WP_022628593  56 VVVDIEITNQMDEAATLDFTSGQKYELVVVDEEGNEVYRYSNEMMFTMALTSETFEPGETKSYQETLStdqwssstht 133 Bacillus marmarensis
Q65LF7        50 IEFRMSVVNHTDDAAEFEFSSGQKFELIVSDKEGNERYRYSKGKMFTQAFQTMTLNPKESYDFTDVWKEVp-EPGTYE 126 Bacillus lichenif...
WP_009794057  41 aEIKVGLINSSDQAQVFEFPTSQRYDLIIRDKSGEIVYDASAGKSFLQAIQYLKLNPGEFVSWTESWDYEt-ASGRvg 117 Bacillus
WP_013406792  64 LEIKIEIINNSDSERTLEFSSGHKYNIYVKDESGTKIYSWAEDKMFIQAFQYVDISAGETHYFEQEIDLSqfEKGDYI 141 Halanaerobium hyd...
WP_013489538  78 LQVSITLKNEAESARKLEFSSGHQFDIIVKDQEGNVIYDYAADRMFTQAFIFEEVGESEALTFNDQWYSEs--LGDYE 153 Bacillus cellulos...
WP_014642526  70 ADFQMSLENTSDETVTLGFTSSQEYEIHVTNAEGESVYTFSADKMFTQEMINKDLVAGESLTAEETWTGIe-EPGDYE 146 Halobacillus halo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap