Conserved Protein Domain Family
TPR_5

?
pfam12688: TPR_5 
Tetratrico peptide repeat
BH0479 of Bacillus halodurans is a hypothetical protein which contains a tetratrico peptide repeat (TPR) structural motif. The TPR motif is often involved in mediating protein-protein interactions. This protein is likely to function as a dimer. The first 48 amino acids are not present in the clone construct. This Pfam entry includes tetratricopeptide-like repeats not detected by the pfam00515, pfam07719, pfam07720 and pfam07221 models.
Statistics
?
PSSM-Id: 403783
View PSSM: pfam12688
Aligned: 5 rows
Threshold Bit Score: 144.594
Threshold Setting Gi: 81391132
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6AFZ9         39 PHALFEAAGARDFVGDEAAAEPLYRRALANGLPEPQRGQATIQLASTLRVLGRPEDALILLRELLTghPGHELRDAVCAF 118 Leifsonia xyli...
Q9RUW3         41 SVALFERAGARDSVGREAEAVQLYEQALAAGLSGVRRRRAVIQLASSLRNVGQVERGLALLEAEQQr-GPDELSDALSAF 119 Deinococcus ra...
jgi:Tpau_3883  36 GVAAFERAGVEDSTGHPDRAVPGYRRALDAGLDDSRARQATIQLASSLRNLGEAADGLALLNGLATd-RGDGLDGAIAVF 114 Tsukamurella p...
jgi:Snas_2938  47 GIAAFERACSFDSTGHSDKAVPLYREALENGLTGIRRRRAVIQLASSLRNVGHPEESLRLLTAEMEa-GSDELDDALRCV 125 Stackebrandtia...
WP_012243769   42 PQISFARGGFFDSTGHPEQAIPLYRQALAEGLAGAQRRQLTVQLASSLRNLGELDEAEALLRAEVAr-PQNEYTAALQGF 120 Renibacterium ...
Q6AFZ9        119 AALALFDAGLPAEAVREALGALAAHLPLYRRAVTAYPAEL 158 Leifsonia xyli subsp. xyli
Q9RUW3        120 LALMLVDTGREREAVATVLTALAPHLPRYQRSVTNYARLL 159 Deinococcus radiodurans
jgi:Tpau_3883 115 RALCLADLQRPNEAIAMLIDSVAEGMTRYRRSAQAYADEL 154 Tsukamurella paurometabola DSM 20162
jgi:Snas_2938 126 MALTLTALGREREAVSILLIAMADHLPRYQRSMKNYARLL 165 Stackebrandtia nassauensis DSM 44728
WP_012243769  121 LALVLSSQGKEREALSISLLALVPHLPRYQRSMTNYAQAL 160 Renibacterium salmoninarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap