2QNT


Conserved Protein Domain Family
Glyoxalase_2

?
pfam12681: Glyoxalase_2 
Click on image for an interactive view with Cn3D
Glyoxalase-like domain
This domain is related to the Glyoxalase domain pfam00903.
Statistics
?
Aligned: 7 rows
Threshold Bit Score: 159.887
Threshold Setting Gi: 81434357
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QNT_A     9 FVNPIPFVRDINRSKSFYRDRLGLKILEDFGSFVLFETGF--AI-----H--EG--RSleetiWRT---SS-DA-QEAY- 71  Agrobacterium fabru...
CAL81996   3 FKLALLAVKNVSVSRQFYEELFDQKVILDLGKNVTFSGGF--AI-----Q--ED--FA-----WLT---NVaSD-SVIE- 61  Clostridium botulin...
Q97LL1     3 FNCPLIVVNDINISRKFYEEVLCQKIKYDFGENVVYEGDF--SL-----QlkSH--FA-----NMI---DI-DEkSIKF- 63  Clostridium acetobu...
Q187Q5     3 FGGVLLIVKDINKSKKFYEDVMEQKITLDLGEHVSFENGF--GL-----Q--SN--YK-----AII---GY-DL-PIYQ- 60  Clostridioides diff...
AAK87638   3 FVNPIPFVRDINRSKSFYRDRLGLKILEDFGSFVLFETGF--AI-----H--EGrsLE-----ETIwrtSS-DA-QEAY- 65  Agrobacterium fabru...
Q81BZ3     5 MKYIILYVEKFEECLKFYKDILQLPIKAEHGTYIEFNTGT--TIlamntR--QD--VK-----ELT---GL-PL-TEGEl 68  Bacillus cereus ATC...
Q8TUF9    12 FICPLIVANNMEISRNFYEKVLDQKVQYDFGENVSFEGGFviHL-----K--SH--FS-----DLI---NI-NKnDIAQ- 72  Methanosarcina acet...
2QNT_A    72 GRRNXLLYFEHADVDAAFQDI--APHVELIHPLERQAWGQRVFRFYDPDGHAIEVGESLS 129 Agrobacterium fabrum str. C58
CAL81996  62 RSNNMELYFEVDDFDAFMQKIqeYENIKYVHQPKKYKWKQRVVRIYDPDHHIIEIGESMA 121 Clostridium botulinum A str. ATCC 3502
Q97LL1    64 QSNGFELYFEEDNIEAFLNKLkqNKGINYIHSLLEHPWGQRVIRFYDPDMHIIEVGESME 123 Clostridium acetobutylicum
Q187Q5    61 QSNNFQLYFEVNDIKQWESKInrIGNIEFLHYIKEYPWGQRTFRFYDFDKNIIEISESME 120 Clostridioides difficile 630
AAK87638  66 GRRNMLLYFEHADVDAAFQDI--APHVELIHPLERQAWGQRVFRFYDPDGHAIEVGESLS 123 Agrobacterium fabrum str. C58
Q81BZ3    69 QSSHFELGFVVENVQETIEQFreQG-IKILVEPIVKPWGQTIAYIADPDGNYIEICSSLE 127 Bacillus cereus ATCC 14579
Q8TUF9    73 KSNNSELYFEEADLDSFLQKLkdIDSIEYVHGLKEQPWGQRVIRFYDPDMHIVEIGEPME 132 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap