Conserved Protein Domain Family
MnmE_helical

?
pfam12631: MnmE_helical 
MnmE helical domain
The tRNA modification GTPase MnmE consists of three domains. An N-terminal domain, a helical domain and a GTPase domain which is nested within the helical domain. This family represents the helical domain.
Statistics
?
Aligned: 483 rows
Threshold Bit Score: 255.461
Threshold Setting Gi: 309398696
Created: 28-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAR30948                153 LIEVEGIRELIDAETETQRRCALSSFNGMNKNLFMLWRDKIVNNIAQLTAIIDFGE---D--T----EIEDtnnllqLVK 223 Zygo...
BryantPSU:Cabther_A1604 130 LAQAEGLRDLIHAQTTYQARLAAQQMRGALSTRLQPLKEQLLTTIVHLESAVEFVE------EqldtHSRA------TLV 197 Chlo...
jgi:AciX9_3767          129 LTQAEAVHDLIEATTLHQARIAAAQLGGALSKIVAPIKRRLVELIAGLEAGVDFAE---D--Dld-lMTEA------EIA 196 Gran...
tigr:ACP_2183           139 LTQAEAVRDLIDAQTLYQARVAAEQMGGALSRRVQPAKQQLVELIALLEAGIDFAE---D--Dvd-vTPNA------QIL 206 Acid...
Q1IHC2                  128 LTQAEAVRDLIESQTLYQARVAAQQLGGSVSRRLQPTKQKLVNLIAVLEAGIDFAD---D--Dvs-vLPAK------EAI 195 Cand...
jgi:AciPR4_4274         127 LTQAEAVRDLIDAQTIEQARVAAEQVGGSLAKRIRPCKEDLVALIALLEAGIDFAE---D--Did-vAPSA------QIE 194 Terr...
A0LE48                  139 LVQAEALMGLIEATSLRAAREASRQMTGTLSEHLMALKDHLVLTYAHLEAALDFSD---E--Die-pESEG------GLL 206 Magn...
jgi:SpiBuddy_0833       130 LTQAEAVGELVSSQSQISRSLALGRLEGSLRGRIAAMKEQLLGIVAAVEVQLDYAEdelD--E--------------FVF 193 Spha...
jgi:Spith_0275          129 LTEAEAVHEVVSARTANAHTLALHRLEGRLRARIDAIKEKIASVVAEVEVQLDYPE---EdvE--------------HPV 191 Spir...
jgi:Spirs_3830          132 LTEAEAVAEIIDAKSSAAHAMAMDRLSGSLFRSIDALKKRIVEVLASVEVLLDYPE---E--El--lDAPE------PDF 198 Sedi...
CAR30948                224 HN--MVQLKQEINQFIQKIEKTSILQSGVKVVLLGPPNAGKSSLINSISNDDVSIISHTPGTTRDTVEASIDVNGYKVTI 301 Zygo...
BryantPSU:Cabther_A1604 198 EE--LSHLETQVRQLAATYRAGRLIREGLALAIVGRPNVGKSSLFNALLDADRAIVTDVAGTTRDTLQEVATIGELPVRL 275 Chlo...
jgi:AciX9_3767          197 AR--IESVRDPLQALAATYDYGRIVREGFTLAIVGRPNAGKSSLFNRLLVRQRAIVTDQPGTTRDAISERMSIEGIPVEL 274 Gran...
tigr:ACP_2183           207 TR--IDAMQPILESLHRSFARGRLVHSGLTLAIVGRPNVGKSSLFNRLVERERAIVTAMPGTTRDLVSERVSLGGIPLEL 284 Acid...
Q1IHC2                  196 AR--IAEVHEPLAKLKEGFAFGKVVHEGLTLAIVGRPNVGKSSLFNRLVERDRAIVTAIPGTTRDLVTETVSLGGIPVHL 273 Cand...
jgi:AciPR4_4274         195 AR--LQAVLSPLEDLLATFAYGRILREGVRIAVIGRPNAGKSSLFNALAERERAIVTPIAGTTRDVVTERVSIGGIPVEL 272 Terr...
A0LE48                  207 DR--LAYVHAGIKKMLGTAELGRQMRDGFELAIVGRPNVGKSSLFNALSGEDRAIVTDLAGTTRDLNESNLEIHGLPILL 284 Magn...
jgi:SpiBuddy_0833       194 PRsgLVDLIKQVKDLSATYQIGRLYRMGARIVLAGSTNAGKSSLFNLLLKQERSIVSPVRGTTRDYIEADLDVQGIPIRL 273 Spha...
jgi:Spith_0275          192 SAhlIQEASHEVDGLLATYRVGRLYREGVRVVLAGRTNAGKSSLFNLFMREDRAIVSEVHGTTRDYLEGWISLKGVPVLL 271 Spir...
jgi:Spirs_3830          199 AP--LSEVLHSVEALSATFQEGRLYREGAKVAIAGRTNAGKSSLFNLFLKEDRSIVSDIHGTTRDYIEAWTTIAGIPVCL 276 Sedi...
CAR30948                302 SDTAGIR----S-HsSDEIELLGIERAIKKSEQCDLCLLIVDplnkplinedltqmiqsmykegkE-------------- 362 Zygo...
BryantPSU:Cabther_A1604 276 MDTAGIR----D-T-SDIVERMGVERSYRALADADIVLFVVD-----------------------Aaagphpderq---v 323 Chlo...
jgi:AciX9_3767          275 IDTAGLRtapdG-P-EGEAERQGIERTNVAMAEADLVLHVVD-----------------------Ggaltkdide----- 324 Gran...
tigr:ACP_2183           285 VDTAGLR----E-G-ADEAETIGIQKSREALADAHLVMLVVE-----------------------Gntplseeeqa---l 332 Acid...
Q1IHC2                  274 VDTAGIR----E-S-HDEAESIGIQKSREAMADADLVLVVVD-----------------------Ahaetgheldhq--l 322 Cand...
jgi:AciPR4_4274         273 MDTAGLR----E-S-EDFVEQLGIARSREALAEADLVLFIVD-----------------------Lqhgiseeere---t 320 Terr...
A0LE48                  285 VDTAGLR----EsD--DPVERIGIERAWQRVERADGIVFVAE-----------------------Aqlgvtledka---- 331 Magn...
jgi:SpiBuddy_0833       274 YDTAGLR----EsD--DAIESEGIRRTERLIGQADLVVYLVDstelghv------------------------------- 316 Spha...
jgi:Spith_0275          272 YDTAGIR----DgG--DPVEAEGIRRTREILSHADAVIYLVD-----------------------Gteglsegeea---l 319 Spir...
jgi:Spirs_3830          277 YDTAGLR----DaG--HPVEVEGIRRSGKVVDAADLVLYLID-----------------------Gttgpspdefsllad 327 Sedi...
CAR30948                363 ---------FViIVNKQDLLTDENQsksvmd---------alrekfGDKFPIITV--------------------SCKT- 403 Zygo...
BryantPSU:Cabther_A1604 324 ighlrqrqaIC-VVNKLDLMPSVVPfel---------------flqEHDLTCPVVg------------------vSAHTr 369 Chlo...
jgi:AciX9_3767          325 ivvaearpyLR-VLNKSDLLSAGV----------------------GAEASEGAIr------------------tSALTg 363 Gran...
tigr:ACP_2183           333 aaslagrraLL-VRNKSDLVQQKSLldtqpealfasppeassekesETVTNIRAVs------------------tSALTg 393 Acid...
Q1IHC2                  323 isaaaersaIL-VENKIDLGRHSV----------------------ANGKSIPVVr------------------tSAVSg 361 Cand...
jgi:AciPR4_4274         321 iaslegrphLV-VANKIDLAPLL-------------------------ASDFALIp------------------tSANTg 356 Terr...
A0LE48                  332 llqrlpkekALwVWNKLD------------------------------------QlegalpeclqdwpeeqicgvSCHTg 375 Magn...
jgi:SpiBuddy_0833       317 ---pkederTLvVYNKSD------------------------------------Lvkppk----------grmaiSAQTg 347 Spha...
jgi:Spith_0275          320 iaelgaerpLIpVWNKVD------------------------------------Asavlppp-------egfiplSCRTg 356 Spir...
jgi:Spirs_3830          328 qtsaegqgrYIfVMTRSD------------------------------------Lgcqvwd--------dgvvavSAVTg 363 Sedi...
CAR30948                404 -QegIEPLVKQLTQiFQrL--SEtsdESD------------PIIASRRVKEILHsDVLYGIdsffV----------Ttds 458 Zygo...
BryantPSU:Cabther_A1604 370 aG--LAELKATIQQvAV-Gs-SFd--TSQd-----------WLVTDARHAAALT-AAAEAL----Gcarel-laegH--- 423 Chlo...
jgi:AciX9_3767          364 eG--IEELKRAIVMaLT-Qt-ATp--PES------------AVLTNVRQHGAIM-QAVDAL----Eiaava-aqdgL--- 416 Gran...
tigr:ACP_2183           394 eG--IAGLRETLLQmMQ-Ae-GMg--SES------------GMLTSLRHHEAVS-AALAAL----Gkaraa-aqagI--- 446 Acid...
Q1IHC2                  362 eG--IAELREQILRmVS-Ge-SGr--EES------------GFLTNIRQHQLVT-DSLAAL----Eaatna-levrV--- 414 Cand...
jgi:AciPR4_4274         357 eG--LDRLREALLQqLR-Gs-QNa--SAS------------GLLTNLRQRDAVA-RAVEAL----Hraiea-ihasI--- 409 Terr...
A0LE48                  376 eG--LESVVAHI----------------VarmeqlpehgegVVIMQLRQQQTLQ-QAIVLI----EeaqemlangqW--- 429 Magn...
jgi:SpiBuddy_0833       348 eG--VPNLLAEIAKrLAkGsvS------Sgd--------eqVVIESERQHTLLE-NAAQAL----QrclvlvdqdiP--- 403 Spha...
jgi:Spith_0275          357 eG--FARLEETLHRvFPeA--E------Ggg--------aeVVIDSERQRDALV-RCRDSL----EggldalsrgaP--- 410 Spir...
jgi:Spirs_3830          364 qG--LDRLQKKMAKcLSaKa-P------Lts--------gePVVDSLRQKRLLD-RCSSAL----Qavleg--------- 412 Sedi...
CAR30948                459 eiggdSYDVVmaSEHLSHAADGIGKITGDaVGIEEVLGVVFANFC 503 Zygosaccharomyces rouxii
BryantPSU:Cabther_A1604 424 -----SEEVP--LAELHRALHALGDITGE-TGIEEVFDRIFATFC 460 Chloracidobacterium thermophilum B
jgi:AciX9_3767          417 -----PHELL--LLDLYGALDALDRLTGA-TSADEILNLIFSTFC 453 Granulicella tundricola MP5ACTX9
tigr:ACP_2183           447 -----PHEMV--LLDLYEALRQLDSLTGE-TTADDILNRIFSTFC 483 Acidobacterium capsulatum ATCC 51196
Q1IHC2                  415 -----PHEMV--LMDLYNALRPLDDITGA-TTADDILNLIFSTFC 451 Candidatus Koribacter versatilis Ellin345
jgi:AciPR4_4274         410 -----PHEML--LLDIYEALRGLDELTGS-TTADEILGVIFSTFC 446 Terriglobus saanensis SP1PR4
A0LE48                  430 ------LELV--AEPLTRSIDQLTQLMGN-TDYEDVLGMVFSSFC 465 Magnetococcus marinus MC-1
jgi:SpiBuddy_0833       404 ------LDIT--AVELGEALQNLGELTGE-VTPADILQKIFSGFC 439 Sphaerochaeta globosa str. Buddy
jgi:Spith_0275          411 ------LDAL--AVYLHDAMEALGEITGE-VTREDILERIFSCFC 446 Spirochaeta thermophila DSM 6578
jgi:Spirs_3830          413 -vgsrsWDEL--AMDLKDAVDALGEITGE-VTSADILESIFSGFC 453 Sediminispirochaeta smaragdinae DSM 11293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap