Conserved Protein Domain Family
MnmE_helical

?
pfam12631: MnmE_helical 
MnmE helical domain
The tRNA modification GTPase MnmE consists of three domains. An N-terminal domain, a helical domain and a GTPase domain which is nested within the helical domain. This family represents the helical domain.
Statistics
?
PSSM-Id: 338428
View PSSM: pfam12631
Aligned: 489 rows
Threshold Bit Score: 256.614
Threshold Setting Gi: 754172971
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25009491  126 LTQAEAVIDVIHGKTEKSLSLSLNQLRGDLRDKIATIKKSILDLAAHINVVLDYPEEGid-dPVPE-NLVENLK-KASAE 202
gi 205829164 131 LTKAEAVIDVLSAKTRKGVDVAQEQLAGSLYRRIEPIRNALVHMRALFEVAIDFPDQShd-iVDYE-QIDLQLKtEVIAP 208
gi 503708481 132 LTKAEAVQQVIASKNSLAMQAAENQLQGKLYKTIASFQQKLTDIAAILEAWVDFPE-EglefASHE-EMLTMLT-AIIER 208
gi 502947850 126 LSQAEAVQELIGAKNERALDASKQQLQGRLSDKILSFQSQLNSIAAILEAWVDFPD-EglefASFE-EVCSDLE-SVIGE 202
gi 501821622 127 LVQAEAIMDIIHSKSEMSLNLAQHQREGLLSRQLFQLKEYLLSSLAFLEAFIDFPEEDid-vSAKE-HIGQNID-SSLLM 203
gi 505940679 130 LTRAEAVVDLLQAQTEKGALLAVNQLRGALFAELEQIRDHLLSILAVLEVAIDFPDEDae-iFAAQ-QIQDQLQtHLIGP 207
gi 502929756 135 LTRAEAVLDVLNAGTREGLNLAMSQLQGGLQQQLEPVRRALLEVLAVVEVAIDFPDEDae-iIDTA-ALGRRLElEVRQP 212
gi 503675318 132 LSQAEAIQELVSAKTETALNLALNTLLGKLSNKINALKNDLLEILVLVESAIDFPEEDie-iMEPE-KLSQKIKeKILPV 209
gi 503673180 134 LSQAEALLDLINARSEESLKLALNQLRGALAEKLRPVREALLSALAVVEVAVDFPDEDve-iISHY-ELAENLEnQVLEP 211
gi 501880604 131 LTQAEAVADIINARTAGALKIAAAQGTGELKDAIHGAREILIELLALLEAAIDFPD-Etq-dLVPSdQGIVRVK-QVLTA 207
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25009491  203 IKDLVSSYDKGKIIKDGIKTAIIGKPNVGKSSILNSLLREDRAIVTHIPGTTRDIIEEVININGIPLLLVDTAGIRN-TD 281
gi 205829164 209 VKELLAGVDRGRIYRQGISMVIAGRPNVGKSSLLNAVLQEERALVTSIAGTTRDSIEEMVDILGMPVRIVDTAGIRR-QA 287
gi 503708481 209 MQHLLATFHEGKRLQTGLSICLLGAPNVGKSSLMNAIVGKDRAIVTDIPGTTRDILEEEIEMAGLNFRLLDTAGIREaE- 287
gi 502947850 203 MKELKSTYHDGKILHDGISLCLIGRPNVGKSSLMNALLDKERAIVTDTPGTTRDIVEDSLRINGLNFRLIDTAGIREgA- 281
gi 501821622 204 LDELLSGFSEGRIIREGVSVVIAGKPNVGKSSLLNALLQEKRAIVTAIPGTTRDLIEEQMTINGLPVKLLDTAGIRE-SD 282
gi 505940679 208 LERLIAMAEQGKIVREGVKVVITGQPNVGKSSLLNTLLQEERALVTPLPGTTRDTIEERIAIRGIPLHLVDTAGIRL-HH 286
gi 502929756 213 LQELLERADRGRIFREGATVVILGRPNVGKSSLLNALLQDERAIVTAIPGTTRDTIEECLNIHGMPLRIVDTAGIRE-TT 291
gi 503675318 210 IEELIKNYEEGKIYKEGISLVIAGKPNVGKSSLMNALLKEERAIVTPIPGTTRDFLEEEATIEGLPVKLIDTAGLRE-TE 288
gi 503673180 212 LKELLKNYQEGRLYREGIAVVIAGRPNVGKSSLLNALLAEERAIVTPIPGTTRDIIEEFATIKGLPVRLIDTAGLRE-TE 290
gi 501880604 208 CEKFIQTYEEAHFLRDGIKLAICGPPNVGKSSLMNRLLQKERSIVTELPGTTRDLIEETLNINGITFLVSDTAGMHQ-TD 286
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25009491  282 DIVENIGVEKSKELINSADLILYVIDTsreideedfriydiintdkvIG-ILNKIDIKKEINLs----------KFPKIE 350
gi 205829164 288 GEVEALGIQRAKDLINSADLVLFMVDGsrqldqsdlelyediahkpmIA-VINKLDLLAEDGTaaaa----lldFVPASV 362
gi 503708481 288 EIVEREGVRRSIAAAKEADLILLVVDIsnpsidsdl---mailpkgqTLlVWNKTD------------------------ 340
gi 502947850 282 ETIEQEGIRRSKEALEKADLVLLVLDAkrgvtaedeq-lidlvpkgkTIaVWNKID------------------------ 336
gi 501821622 283 DHVEKEGVKLSLEKLSSADLVLFVVDAsssfsaedqsilerlsgfsfMV-VKNKSDIDGSYVL-----------PFEPEL 350
gi 505940679 287 DPVEALGIERARQKVEQADLVLFLVDAqvgwretdeelyrslgnkphVI-VVNKRDLATKEQIas-------ifSRFSGK 358
gi 502929756 292 EEVEGIGIERSRRRVAEADLVLLLVEAgsepssedmalfdsvrekkvLV-VVNKLDLLGDASPaaaeaalaawrHRFPGR 370
gi 503675318 289 DIVEKIGVERAKKKFKEADLILFLVDVsehpssedykiyqevknfshLV-ILNKIDIQPNHIKewk-----evlLKWGID 362
gi 503673180 291 DLVEEIGVKKAKEKIATADVVIFMLDGslepteedlklyqeikamphLV-VINKIDIASHENLnr-------yrEIFPQE 362
gi 501880604 287 DLVERIGIERAKKHIAASDLILFMKGAdkeisesel--qsivpkdkkVIlVINKIDLIEGKTAgsagv-ekslpPTLAQL 363
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25009491  351 KWIe--------------iSALSklGIDNLENEIYK-YI-Mn--eNIeDSSq-----------kLVITNVRHKSALEKTN 401
gi 205829164 363 PRLa--------------iSAREgeGLEALKQAIFT-VVtGsdtpW---DEe------------GCAPNLRHKKSLEATL 412
gi 503708481 341 --LkaadelpklpfeavrvSAKNyeGLEELKEAV----------------HqivwksgppskeeVVLTNERHFQSLDRAI 402
gi 502947850 337 --LphdeapqlgipyivpiSAKEkkGLKQLHEQI----------------DrvvwehgppskeeILITNVRHKESLSDAI 398
gi 501821622 351 PVLs--------------lSTHTghGLVDLQQAIFD-FFiHlp-dH---DSre----------fVAISQVRHRDALTGCR 401
gi 505940679 359 KVVa--------------iSAKQqeGIDELQEAVYQ-AIiG----DG-AELce---------rmTCAPNTRHRSILHKTL 409
gi 502929756 371 ELTg--------------iSARArvGLEQLEDLVFR-LIsGdeprD---PGy------------ACVPNARHRAALARTL 420
gi 503675318 363 EVLe--------------iSVKEniNLDKLCKKIFE-KItSekgaH---VP-------------EVVPNLRQKIALENAK 411
gi 503673180 363 KLIf--------------iSARTgeGLEALAEAIFE-LVtGrteeF---IP-------------SVVPNLRQKMAIENAL 411
gi 501880604 364 PQVr--------------iSALKntGIDHLRKTITRlSM------EN--IGea----------sSVVPNLRHRTALKRAI 411
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 25009491  402 EALLniiet-idmgL-PMDLMAVDIKDALDSLSEVTGEISSEDLLDHIFSNFC 452
gi 205829164 413 IAAErmvdd-laqgMgSSDLLSIDMQECLDQLGDIIGITTTDDVFDVIFSEFC 464
gi 503708481 403 QATQkvslglqeelS--PEFLTSDIRLALKELGTIIGVNITEDILSAIFSKFC 453
gi 502947850 399 AACEkvleglrsdiS--PEFVAFDMRDCLENLGKVIGTDVTEDILSAIFSKFC 449
gi 501821622 402 NALAnfkdn-ldreV-NLDLLAIDLRDALDSLGAVTGETTADDVLDRIFQQFC 452
gi 505940679 410 TACRgfeaa-mamaA-PVDLLAVEVQSALDHLGDIVGLTTPDDVLDVVFSQFC 460
gi 502929756 421 PALErvqqg-laagL-APELLAVELQACLGSLGEIIGEVGSEELLDTIFSSFC 471
gi 503675318 412 EYLLnalre-lekkDpLPELIAIEIRSAISSLSEIIGEVTTEDLLTQIFSTFC 463
gi 503673180 412 KATEqaisn-lkktDiYPELIAIDLRDALSSLGEITGETTTEDLLDRIFSNFC 463
gi 501880604 412 KSLKtaeagflngqN--EETLALDIRRAADLLGEITGNTAGIDILDTIFSNFC 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap